KEGG   Magnetococcus marinus: Mmc1_3390Help
Entry
Mmc1_3390         CDS       T00427                                 

Definition
chemotaxis protein CheR (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mgm  Magnetococcus marinus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mmc1_3390
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mmc1_3390
Enzymes [BR:mgm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Mmc1_3390
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mmc1_3390
Two-component system [BR:mgm02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mmc1_3390
Bacterial motility proteins [BR:mgm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mmc1_3390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4225221..4227074
Genome map
AA seq 617 aa AA seqDB search
MVDLFLTHEAQGSWSCHPLLMLEERRDMSSNETTPPRTKLMDPVIANPPTHYIGIGASAG
GLEAIQAFFSHMPANSGAAFIVVQHLSPDYKSLMVELLSKQTNMEVTRITDGMPVEANTV
YLIPPKKNVKIFHGRLILTDQTHNNIGINLPIDIFFVSLAEDQGRKAVGIILSGAGSDGT
RGVKSIKEKGGMVMVQEEATAKFDSMPKSAIATNLPDFILPPDEMPSQLLAFVKHPYATR
ELMTDKLAEKGTGLTRIFALLRENSSIDFTFYKPSTVMRRIERRMTINQYEDLDDYVHFL
EANPREQTVLFRELLIGVTSFFRDADAYQILQESIIPELVKNNTGKQIRVWASACSSGEE
AYSLAILFMEAMQKSEAAVDIKIFATDVDQDAIFRASQGAYPESIVADVPAPLLNKYFMH
KGDNYHIIRQVREMVVFAQHNIIKDPPFTNINFVSCRNMLIYFQPVLQQKVLEGFNFSLA
TDGILFLGSSETPGEMDSFFNTLHAKWKIYRSKGIRKVASANRPLSQYEPKHWVGGRAGG
RLETTTTGRYLEEERILSRFVQTISGNYLPFAVVVNDNLQLVQVLGDTLDYMRIPFGSPI
TDISKMVADDLYIPVST
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggtggacctttttttgacccatgaggcgcaaggatcatggtcttgccacccccttttg
atgcttgaagagagaagagacatgtcctcgaacgaaacaacgccaccccgcaccaagctc
atggatccagtgatcgccaacccccccacacactatattggtataggggcctcggcaggc
ggcttggaggcgattcaggcatttttctctcacatgcctgccaacagcggggccgccttt
attgtggtgcaacacctctcccccgactataaaagtctcatggtggagctgctctccaag
cagaccaatatggaggtcacgcgcatcaccgacggtatgccggtcgaagccaacacggtc
tatctgattccccctaagaagaatgttaaaatcttccacggacgtctgattttaaccgac
caaacccataataatattggcatcaatctgcccattgatattttctttgtctcccttgca
gaggatcaggggcgtaaggcggtgggtattattctgtcgggtgcgggcagcgatggcaca
cggggggtcaagagcatcaaagaaaagggcggcatggtcatggtgcaggaggaggccacc
gccaagtttgacagcatgcccaaaagcgccatagccaccaacctgcccgattttattctg
ccccccgacgaaatgcccagccaactgctggcttttgtcaaacacccctatgcgacccgc
gagttaatgaccgataaactggcggaaaaaggcacgggcttaacccgtatttttgccctg
ctgcgggaaaacagcagcattgattttaccttttacaagccctccaccgtgatgcgccgt
atcgagcgccgcatgaccatcaatcagtacgaagacctggatgactatgtacacttttta
gaagccaatccacgggaacagacggtgctgttccgtgagctgttaattggcgtcaccagc
tttttccgcgatgccgacgcttaccagattctacaagagagcattatcccagagttggta
aaaaataatacaggcaaacagatccgggtgtgggcctcggcctgctcctcgggggaggag
gcctactccctagccattttgtttatggaggccatgcaaaagagtgaggctgcggttgat
ataaaaattttcgccaccgatgtggatcaggatgccatttttcgcgccagccaaggggcc
taccccgagagcattgtggccgatgtgcccgccccattattaaataaatactttatgcac
aaaggggataactaccatattattcgccaggtgcgcgagatggtggtgtttgcccagcac
aatattattaaagatcccccctttaccaacatcaactttgtttcttgccgcaatatgttg
atctatttccagcccgtgctgcaacaaaaggtgctggagggctttaacttctccctggcc
acagacggtattctcttcttgggcagtagcgagaccccgggtgaaatggacagttttttc
aacactctgcatgccaaatggaaaatctaccgcagcaagggcatccgtaaagtggcctca
gccaaccgccccctcagccaatatgaacccaaacattgggttggtggtcgcgcaggtggc
cgcttagaaaccaccaccaccgggcgctaccttgaagaagaacgaattctcagccgtttt
gtgcagacaatctcaggcaactatctaccctttgccgtggtggtcaacgataacctgcaa
ttggtgcaggtgctgggggataccctggactatatgcgcatcccgttcggctctcccatt
accgacatctccaaaatggtggccgatgatctctatattcccgtttctacgtaa

DBGET integrated database retrieval system