KEGG   Magnetococcus marinus: Mmc1_3474Help
Entry
Mmc1_3474         CDS       T00427                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
mgm  Magnetococcus marinus
Pathway
mgm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mmc1_3474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ABK45959
JGI: Mmc13474
UniProt: A0LDB6
Position
4336638..4337054
Genome map
AA seq 138 aa AA seqDB search
MSGTPAWGARALLLLAVLTVVFATKRESAIAAGEHQPASLRACRVCHDLSSEKKSQGFIG
PPLWGVANRSIGSENSFAGYSETLVSMGAHGKIWDRRTLERYLADPRMFAPGCRMAFTGI
ADEKSRMQAVDYLFSMQD
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtacaccagcctggggggcaagggcattactgctgttggctgtgctcaccgtg
gtgtttgccaccaagcgtgaatcggccatcgcggctggggagcaccagcccgctagccta
cgcgcctgccgagtgtgccacgatttaagctccgagaaaaaaagccaaggctttattggc
ccccccctgtggggggttgccaaccgctccatcggttcggaaaacagctttgcgggttat
tcagagaccctggttagcatgggtgctcatggtaaaatctgggaccgtcgcaccctggag
cgctatctggcggacccccgcatgtttgccccgggatgtcgcatggcctttaccggtatc
gcggatgaaaagagccgcatgcaggccgtggattatctcttttccatgcaggattaa

DBGET integrated database retrieval system