KEGG   Magnetococcus marinus: Mmc1_3475Help
Entry
Mmc1_3475         CDS       T00427                                 

Definition
cytochrome C, class I
Orthology
K08738  
cytochrome c
Organism
mgm  Magnetococcus marinus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mmc1_3475
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mmc1_3475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4337061..4337906
Genome map
AA seq 281 aa AA seqDB search
MKLDRDIFTVLLMAAVCVVILLIFGVVKRTTAPILNTTPDYANRGRELARQCLPCHDLTP
ARTLSEKGPPLWGIVDAMAGHTLYPYSEGYMELAKRCLVWNEANLDRFLTDPKRFMPGTR
KDYAPIADPEQRRLLIEFLTSLQDPQVTQPTLVAAENYAQVSATLNRMRGENAKRWRKAG
AKEAQKCTACHDLTQSAEIIVGPPLVDIVEREVGSSKGFCYSPGFRRWMENKENPKVWDE
VSLYRFLYAPQSHIPHTRMLFRGVRDDYKRAALIGHLKRLP
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactggatcgggatatttttacggtgctgctaatggcagcggtgtgtgtggttatt
ttactcatttttggcgtcgtaaaacgcaccaccgcgcccatactcaacaccaccccagac
tatgccaaccgggggcgtgagttggcccgccagtgcctgccttgccacgaccttacccct
gcccgcaccctcagcgaaaagggaccacccctgtggggaattgtggatgccatggccggt
cacaccctctacccctattccgaagggtatatggagttggccaagcgctgcttggtttgg
aacgaagccaaccttgaccgttttttgactgaccccaaacggtttatgcccggcacccgt
aaggattacgcacccatagccgatcctgaacagcgccgcttgcttattgaatttttaacc
agtttacaggacccccaagtcactcagcccacactggtggctgcggagaactatgctcaa
gtttcagcaaccctcaaccgcatgcgcggcgaaaacgctaaacgctggcgcaaagcgggg
gccaaagaggcccaaaaatgcaccgcttgtcacgatcttactcaatccgccgagatcatt
gtcggaccccccttagtggatatcgttgagcgggaagttggatcgagcaaaggcttttgc
tactcccccggttttcgccgctggatggagaataaagagaaccctaaggtgtgggatgag
gtgagcctgtatcgttttctctacgcgccccagtcccacataccccatactcgtatgctg
tttcgtggggtgcgggacgattataaacgggccgctttgatcggccatttaaaacgcttg
ccctaa

DBGET integrated database retrieval system