KEGG   Magnetococcus marinus: Mmc1_3581Help
Entry
Mmc1_3581         CDS       T00427                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
mgm  Magnetococcus marinus
Pathway
mgm02020  Two-component system
mgm02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mmc1_3581
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mmc1_3581
Enzymes [BR:mgm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mmc1_3581
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Mmc1_3581
Two-component system [BR:mgm02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mmc1_3581
Bacterial motility proteins [BR:mgm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mmc1_3581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ABK46066
JGI: Mmc13581
UniProt: A0LDM3
Position
4498866..4500146
Genome map
AA seq 426 aa AA seqDB search
MAEKLKAMVVDDTITYRMIMKKVAESIPGVEVVASAPNGKVALEKIPGVQPEVVLCDVEM
PVMDGLATLKEIGQRFPEVTVVMVSGLSRSNANIIMECLNAGALDFVTKPLESNANAAMQ
ALRLDLEPILSVIVSKRKPAGREAAAVVDEVSNPAEPPPARAPFGIPNRAGAVPGARPMP
SPRPGLAARGQAPLPVRPGLPAAIRPGQRAGIPAVARRPMVTPAARPTAGPRVQRPDLLL
IGSSTGGPAALTRVLSVLAGKKLPIPTLIVQHMPPVFTASLASQLSRSSGVEVVEAEAGM
LVTPGGIIIAQGGMHMTLKMLGRQLSVDLNQGPKVNECRPAIDVLFMSIAASFSGQTLSV
ILTGMGRDGTNGVDALKRSSKTYCITQDRDSCVVYGMPRSVEEKGLSDEALPLEQIGKRI
QEICGV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaagttgaaggcaatggtcgtcgatgacaccattacctaccgcatgatcatg
aaaaaggtggccgaatccatccctggtgttgaggtggtggcatcggcccccaatggcaag
gtggcacttgagaaaattcctggtgtccagcctgaagtggttctgtgcgatgttgaaatg
cccgtcatggatggtctggccacgctcaaggagatcggtcagcgttttcctgaagtgacc
gtggtgatggtcagtggcctgtcccgctccaatgcaaacatcattatggagtgcttaaac
gcaggcgcgctggactttgtgaccaagccattggaaagcaatgccaatgcggcgatgcaa
gcattgcgcttggatctggagcccattttatctgtcattgtctccaaacgtaagcctgcg
ggccgcgaagcggccgctgtggtcgatgaggtgagtaacccagcggagcccccaccggca
agggccccgttcggtatacctaaccgtgctggggcggtacctggtgcccggcctatgcca
tcaccgcgaccgggattggcggctcggggtcaggctccgcttcctgttagaccgggtttg
cctgctgccatacgacctggacaacgggcaggtatccctgcggtagcgcgtcggcctatg
gttacaccagcggcgcgtcccacagcggggcctcgggtgcagcgcccggatctgctatta
attggatcttcaacggggggacctgcggcattaacccgtgtattgagcgttttggctggg
aaaaaattacccattcccacgctcatcgtgcaacatatgccgccggtttttacggcctct
ttggcctcccagttaagccgatcgtctggggttgaggtggttgaggcagaagcgggcatg
ctggtaacaccggggggcattatcatcgcccaagggggcatgcacatgaccctaaaaatg
cttggtcggcaactatcggtcgatttaaatcagggacccaaggttaacgagtgtcgaccg
gctatagatgtgttatttatgtctatagccgcgagttttagtgggcagacactctctgtc
attcttaccggtatgggtcgtgatggcaccaacggtgtggatgccctaaaacgtagttcc
aaaacctactgtatcacccaagaccgcgattcatgtgtggtctacggtatgccccgttcg
gtagaagagaaagggctttcggatgaagcacttcctttagagcaaatcggtaagcgtata
caggaaatatgtggtgtatga

DBGET integrated database retrieval system