KEGG   Mycoplasma gallisepticum NC06_2006.080-5-2P: HFMG06NCA_0093Help
Entry
HFMG06NCA_0093    CDS       T02200                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mgn  Mycoplasma gallisepticum NC06_2006.080-5-2P
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mgn00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(15180..16706)
Genome map
AA seq 508 aa AA seqDB search
MDKKKYIITLDEGTTSCRSIVFDKQAKIVSVAQNEFTQYFPQSGWVEHDPLEIWNTQLST
MQSVKNKAQIKSVNVEAVGITNQRETVVLWNKETGLPVYNAIVWQDRRTSEYCETLTKHV
DKVREKTGLIINPYFSGTKIRWILKNVPLAQKTLKAGKLLAGTIDSWLIWKLTGGKVHAT
DVSNASRTLLFNIHTMDWDQELLDLFEIPRSILPEVKSSSEVYGYVEPSLWSQRATAKVP
ITGVAGDQQSALFGQLCLKPGMVKNTYGTGCFTLMNIGEEPIMSKNKLLTTVAWKLGKKK
PVYALEGSVFIAGAAVQWIRDGLRLIYDAAESDFYANLASKQDTHQIYLVPSFTGLGAPY
WDSYSRGAIFGLERGTKKEHIIKATLESIVFQTNDLIKAMSSDVDKKIEVVKVDGGATRS
EYIMQFQSSISGVNVIRPKNIESTALGATFLAGLAVGYWKDLKELEKLVKVDKEFKPKLD
KEKVEKLVHGWNVAVKRTFNWMKEVDLK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaagaaatacattattacattagacgaaggaactacatcttgtcgttcaatc
gtttttgataaacaagctaagatcgtaagtgttgcacaaaacgaatttacgcaatacttt
ccacaaagtggatgagttgagcatgatccattagaaatttggaatacccaactatctaca
atgcaatcggttaaaaacaaagctcaaattaaatcagtaaacgttgaggctgttggtatt
actaatcaacgtgaaactgttgttttatgaaataaagaaacgggacttccggtttataat
gcaattgtatgacaagaccgtagaacaagtgaatattgcgaaaccctaactaaacacgtt
gataaagttagagaaaaaactggtttaatcattaatccttatttctcaggtactaagatt
cgttgaatcttaaaaaatgttcctttagcgcaaaaaactttaaaagctggcaagttacta
gcaggaacaattgattcatgattaatttgaaaactaactggtggtaaggtacacgcaact
gatgtctcaaacgcatcaagaacattattatttaatattcacaccatggattgggatcaa
gaattattagatttatttgaaatccctcggtcgattcttccagaagttaaatcttcttct
gaagtatatggttatgtagaacctagcttatgatctcaacgagctactgctaaggttcca
attacaggtgttgctggtgaccaacaatctgctttatttggtcagttgtgtcttaaacct
ggaatggttaaaaacacctatggaacaggttgcttcaccttaatgaacattggcgaagaa
ccaattatgtctaagaacaaactgttaacaacggttgcttggaaactaggtaagaaaaaa
ccagtttatgcccttgaaggttctgtgtttattgctggagctgctgtccaatgaatacgt
gacggactaagattaatttatgatgcagctgaatctgatttttatgctaatttagcttct
aaacaagacactcaccaaatttatttagttccttcatttactggattaggtgctccttat
tgggactcttattcacgtggagcaatctttggtcttgaacgtggaactaaaaaagaacat
attattaaagcaacacttgaatcgattgtgttccaaactaatgatctgattaaagctatg
tcttctgatgttgataaaaagatcgaagttgttaaagttgatggtggtgcaactagatct
gaatacatcatgcaattccaatcatcaatctcaggggttaatgtaattagacctaagaat
attgaatcaaccgcattaggggcaaccttcttagctggtttagctgttggttattgaaaa
gatctaaaagagcttgaaaaactagttaaagtcgataaagagttcaaacctaaactagat
aaagaaaaagttgaaaaattagttcatggttgaaatgttgcggtaaaaagaacatttaat
tgaatgaaagaggtggatcttaaataa

DBGET integrated database retrieval system