KEGG   Mycoplasma gallisepticum NC06_2006.080-5-2P: HFMG06NCA_3577Help
Entry
HFMG06NCA_3577    CDS       T02200                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgn  Mycoplasma gallisepticum NC06_2006.080-5-2P
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:mgn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HFMG06NCA_3577 (pfkA)
   01230 Biosynthesis of amino acids
    HFMG06NCA_3577 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFMG06NCA_3577 (pfkA)
   00030 Pentose phosphate pathway
    HFMG06NCA_3577 (pfkA)
   00051 Fructose and mannose metabolism
    HFMG06NCA_3577 (pfkA)
   00052 Galactose metabolism
    HFMG06NCA_3577 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HFMG06NCA_3577 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HFMG06NCA_3577 (pfkA)
Enzymes [BR:mgn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HFMG06NCA_3577 (pfkA)
Protein phosphatases and associated proteins [BR:mgn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HFMG06NCA_3577 (pfkA)
Messenger RNA biogenesis [BR:mgn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HFMG06NCA_3577 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(610339..611337)
Genome map
AA seq 332 aa AA seqDB search
MAIQTQRIAILTSGGDSPGMNPAIYGLVQQAIINNIQPYLVYEGYKGLVEDQIVLANQQE
VIDHFFDSGTFIYSARLVEFKDLEVRKKAVSNLKAKKIDTLVVIGGDGSYQGAKLLSEMG
INVIAMPGTIDNDVSSSDYTIGFYSALEHITRTIQEIISTSVSHNRVSISEVMGRHCGDL
AVYAALATKADLVITPENIKTTQEIVDLAAKRMLQDHKRTFTVIVCEHIYGEDGRDSLKT
IAQQINDQLGIKTNLNILTYGQRGQVPTPMERILAMKFAIKAFECINEQRYGVVLGLSGD
EIVAYNFQEALNKRNPSRIKLINLSNRINGGF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggccattcaaacacaacgaattgcgatcttaacttctggaggagattctccaggaatg
aatccagcaatttatgggttagttcaacaagcaatcattaataatattcaaccttactta
gtttatgaaggttataaaggcttagttgaagatcagatcgttcttgctaaccaacaagaa
gtgatcgaccatttctttgattcgggaacgtttatttattcagcaagattagttgaattc
aaagatcttgaagtaagaaaaaaagcagtaagtaaccttaaagcaaaaaaaatcgatacg
ttagtagtgatcggtggtgatggttcatatcaaggcgcaaaactattatctgagatgggg
attaatgtgattgcgatgcctggaacgattgataatgatgtatcttcatcagattacaca
atcggtttttattcagcattagaacatattactagaacgattcaagagatcatctcaact
agtgtttctcacaaccgggtatcgatctctgaagtgatgggacgccattgtggggattta
gctgtttatgcagcacttgcaactaaagctgatctagtaattaccccagaaaatatcaaa
acaacccaagagatcgtagatcttgctgctaaaagaatgttacaagatcacaaacgcacg
tttactgtgatcgtttgtgaacatatttatggtgaagatggcagggatagtttaaaaacg
atcgcccaacagattaatgatcagttaggaattaaaactaatcttaatatcttaacctac
ggtcaacgtggtcaagttcccacaccgatggaacggattctagccatgaaatttgcgatc
aaagcgtttgaatgtattaacgaacaaagatacggcgttgttttaggtttaagcggtgat
gagatcgtagcttacaatttccaagaagcattaaataaacgtaatccttcaagaatcaaa
ttaattaatttaagcaatagaataaacggtggtttttaa

DBGET integrated database retrieval system