KEGG   Mycoplasma gallisepticum NC06_2006.080-5-2P: HFMG06NCA_3594Help
Entry
HFMG06NCA_3594    CDS       T02200                                 

Gene name
aceF
Definition
pyruvate dehydrogenase complex component dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgn  Mycoplasma gallisepticum NC06_2006.080-5-2P
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mgn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mgn00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mgn00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mgn00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(613831..615159)
Genome map
AA seq 442 aa AA seqDB search
MFEYKFTDVGEGLHEGVVAQIYVKVGDTIKEGDPMFSVETDKVTTDLPAPEGGKVTAILA
SVGQTVHVGEVMLVLNGDGSSAPAAAPAPAAAPATPAFVAPTPAVTPAPAPTEAAPSGGG
ASVVGEVKVSNTLFGLFGDQRAASTLTPAPATAFAPTPAPVATPLAQAVASDLNVNLHNV
TPANGAKVFSSDVFASAQQSSLAASVAANDNETYKEITSIRKAIAKAMTTAHEEIPATVL
TFNFDVTKLVSYRKQVKDAVLASYNVKLSFLPFLLKAITKAVVAHPVFNSHYDKASNRLV
LKKKINLGIAVDTADGLMVPNIKSAQDKSVIELAREVNNLAEKARSKKIGLADLADGTIS
VTNFGSIGALFGTPIIKFPEVAIIATGTIEEKLARTPENQIVIKQIMPITIAADHRWIDG
ADIGRFAKTLKEIVENLDGLLI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatataaatttacagacgttggtgaagggctacacgaaggtgttgttgctcaa
atctatgttaaagtaggtgacacaattaaagaaggcgacccaatgttttcagtcgaaact
gataaggttacaactgacttaccagctcctgaaggtggaaaagttactgcgatccttgca
tcagtaggacaaactgttcacgttggtgaagtaatgcttgttttaaacggtgatggttca
tcagctccagctgctgcgccagctccagctgctgcgcctgctactccagcttttgtagct
cctactccagctgttacaccagctcctgctcctactgaagctgctcctagtggtggtggt
gcttcagttgtaggtgaagttaaagtttcaaacactttatttggattatttggtgatcaa
cgcgctgcaagcactctaacaccagctcctgctacagcttttgcgccaactccagctcca
gttgcgactcctttagctcaagctgttgctagtgatttaaatgtaaatttacacaacgta
acacctgctaacggtgctaaagtattctcaagcgatgtatttgcatcagctcaacaaagt
tcactagctgctagtgtagctgcaaacgataacgaaacttacaaagaaattacatcaatt
agaaaagcaattgctaaagcaatgactactgctcacgaagaaattccagcaactgtttta
acattcaactttgatgtaactaaattagtatcataccgtaagcaagttaaggatgctgta
ttagcaagttacaatgttaaattatcattcttaccattcttattaaaagcaattactaaa
gctgtagttgctcacccagttttcaactctcactacgacaaagctagcaaccgcttagta
ttaaagaaaaagattaacttaggtattgctgttgatactgctgatggtttaatggttcct
aacattaaatcagctcaagacaaatcagtgattgaacttgctagagaagtaaacaattta
gctgaaaaagctcgctctaagaagatcggtttagctgatttagctgatggtacaatcagt
gtaactaactttggttcaatcggggctttatttggtacaccaattattaaattcccagaa
gttgcaattattgctactggtacaatagaagaaaaattagcaagaactcctgaaaaccaa
atcgtaattaagcaaattatgccaattacaattgcagctgaccacagatgaatcgatggt
gctgatatcggtagatttgctaaaacattaaaagaaatcgttgaaaatcttgacggttta
ctaatttaa

DBGET integrated database retrieval system