KEGG   Mycoplasma gallisepticum NC06_2006.080-5-2P: HFMG06NCA_4419Help
Entry
HFMG06NCA_4419    CDS       T02200                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgn  Mycoplasma gallisepticum NC06_2006.080-5-2P
Pathway
mgn00010  Glycolysis / Gluconeogenesis
mgn00051  Fructose and mannose metabolism
mgn01100  Metabolic pathways
mgn01110  Biosynthesis of secondary metabolites
mgn01120  Microbial metabolism in diverse environments
mgn01130  Biosynthesis of antibiotics
mgn01200  Carbon metabolism
mgn01230  Biosynthesis of amino acids
Module
mgn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mgn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFMG06NCA_4419 (tpiA)
   00051 Fructose and mannose metabolism
    HFMG06NCA_4419 (tpiA)
   00562 Inositol phosphate metabolism
    HFMG06NCA_4419 (tpiA)
Enzymes [BR:mgn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HFMG06NCA_4419 (tpiA)
Exosome [BR:mgn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HFMG06NCA_4419 (tpiA)
  Exosomal proteins of bladder cancer cells
   HFMG06NCA_4419 (tpiA)
  Exosomal proteins of melanoma cells
   HFMG06NCA_4419 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CO_dh
Motif
Other DBs
NCBI-ProteinID: AFP79949
Position
complement(753024..753782)
Genome map
AA seq 252 aa AA seqDB search
MNSMKRYIFGNWKTYKTTQEVKEFFSVLNQTKLTKNPDVVFGVAPVFVHLGLANQLKRNE
CLVLAQDANYVMNKANTGTVSYEQLKDIGVNYVIIGHSERRKLFHESDELINQKVKTLLE
NKMRPILCIGETLEEYEANKTKAVLKDQLEKDLKGIDSSLLKDLIIAYEPVWAIGTGKTA
SSQTAQDAIAYIRTVLGLLSSKTIANELPILYGGSVTPDNVSELLAQKDINGALVGGASL
DPHKFIQLIEAK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtatgaaaagatacatctttggaaattgaaaaacatataaaactactcaagaa
gttaaagagttttttagtgttttaaatcaaactaagttaaccaaaaacccagacgtggtt
tttggtgttgcaccagtattcgtacatttgggtttggctaatcaattaaaaagaaacgaa
tgtttagttttagctcaagatgctaattatgtaatgaataaagctaacacgggaaccgtt
agttatgaacaattaaaagatattggtgttaattacgtaataattggtcactctgaacga
agaaaattatttcatgaatctgatgaactaattaatcagaaagtaaaaacgctattagaa
aataagatgagaccaattttatgtattggtgaaacgttagaagaatacgaagctaacaag
accaaagctgtacttaaagatcagttagaaaaagatcttaaaggaattgatagttcttta
ttaaaagatctaattattgcttatgaaccagtttgggcgatcggaacaggtaagactgct
tcaagtcaaactgcgcaagatgcaatcgcttatattcgaactgttctaggtttattatca
tcaaaaacgatcgcaaatgagttaccaattttatatggtggatcagttactcctgataat
gtttcagaactgttagcacaaaaagacattaatggagcactagtgggtggagcttcatta
gacccacacaaatttatccaacttattgaagctaaataa

DBGET integrated database retrieval system