KEGG   Mycoplasma gallisepticum NC06_2006.080-5-2P: HFMG06NCA_4885Help
Entry
HFMG06NCA_4885    CDS       T02200                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mgn  Mycoplasma gallisepticum NC06_2006.080-5-2P
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mgn00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(833543..834130)
Genome map
AA seq 195 aa AA seqDB search
MVVIYIMSNKQGLIILISGPSGVGKGTIVSRLLSDNNLKLNVSISATTRKKRASEVEGVH
YFFKTKEEFEQMIANNQLLEYANYVNNYYGTPLSLVKEILDKNENLILEIEYQGVIQVLR
KGFRTLSIFVLPPSEDELVARLKKRGTENDEVIKHRLEQAVKEYAHRELYDHTIINDDLE
KTIEDIKQLIRKYSQ
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggtagttatatatattatgagtaacaagcagggtttaattatcttaatatctggtcct
agtggggttggtaagggcacgatagttagtaggcttttgtctgacaacaacttaaaacta
aacgtttcaatttcagccacaacaagaaaaaagcgagcatctgaagttgaaggtgtgcat
tattttttcaaaactaaagaagagtttgaacaaatgattgccaacaaccaattattagag
tatgctaactacgttaataactattatggaacaccgctttcattagttaaagagatcctt
gataaaaacgaaaacctaattttagagattgaataccaaggggtgattcaagtcttaaga
aaaggttttagaacactaagtatctttgtgcttcccccttctgaagatgagttagttgca
cgactaaaaaaacggggaactgaaaacgacgaagtaattaaacaccgcttagaacaagct
gttaaagaatatgcccatagagaactttatgatcatacgatcattaatgatgatctagaa
aaaacgatcgaagatattaaacaactaattcgtaagtatagtcaataa

DBGET integrated database retrieval system