KEGG   Mycoplasma gallisepticum NC96_1596-4-2P: HFMG96NCA_5234Help
Entry
HFMG96NCA_5234    CDS       T02328                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mgnc  Mycoplasma gallisepticum NC96_1596-4-2P
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgnc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HFMG96NCA_5234 (tdk)
Enzymes [BR:mgnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HFMG96NCA_5234 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
892613..893287
Genome map
AA seq 224 aa AA seqDB search
MAKKNAMTTTNGWIEAICGPMFAGKTDELIRKIKRYEYADVKSLVFSPATDTRSAQEIIN
SRDGRRIGSIKIKKAFEIYDYVLLHKPQLVGIDEVQFFDDSIVEVIQTLADNQINVIVAG
LDRDFRGEPFGPIPKILGIAESVIRLTAICSECGAEASRSQRLIDNQPADYNCETILIGD
TESYAPRCRHHHKVPNRPINDQTKNFKRALKNNFDKIVEQSSKD
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaagaacgcaatgaccaccactaatggttgaatcgaagcaatttgtggtccg
atgtttgctggtaaaacagatgaactaattcgcaagattaaacgttatgagtatgctgat
gtaaagtcgttggtcttttcaccagcaactgatactcgttcagctcaagagattatcaac
tctcgagatgggcgtagaattggttcaataaagatcaaaaaagcatttgaaatctatgat
tatgttttattacataaaccacaattagttggaattgacgaagtgcaattctttgatgat
tcaattgttgaagtcatccaaacattagctgataaccaaattaacgtaattgtggctggt
ttagaccgtgattttagaggtgaaccttttggtccaattcctaagattttaggaattgca
gaatcagtaatccgcttaaccgcaatctgttctgagtgtggtgctgaagctagtcgaagt
caacgtttaattgataaccaaccagctgactacaattgcgaaacgattcttattggtgac
actgaatcatacgcgccaagatgtcgtcatcaccataaagtgcctaaccggccaattaac
gaccaaaccaagaacttcaaacgtgcactaaaaaataattttgataaaatagtagagcaa
tcttcaaaagattaa

DBGET integrated database retrieval system