KEGG   Meleagris gallopavo (turkey): 100008576Help
Entry
100008576         CDS       T01523                                 

Gene name
CLOCK
Definition
clock homolog (mouse)
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100008576 (CLOCK)
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100008576 (CLOCK)
Transcription factors [BR:mgp03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100008576 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 850 aa AA seqDB search
MFFTISTHKMSSIADRNDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGNIIYVSESVTPLLEHLPSDLVDQSVFNFIPEGEHSEIYKILSSHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEQPTYEYVKFIGNFKCLNNVPNSAHNGFEGTIQRS
HRPSYEDKVCFIATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLDNLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGFEESLPEIKADKSQDSGSDNHINTVSLKEA
LERFDTSPTPSASSSSSRKSSHTAVSDHSSTPTKMTVDTSTPPRQSLSAHEKSTQRRSSL
SSQSLSSQSLGQPVTQPTMSQPATLQLQSSMSQFSAQLGAMQHLKDQLEQRTRMIEANIH
RQQEELRKIQEQLQIVHGQGLQMFLQQSTSGLNFSSVQLTSGNSSSVQQLAPANMQGQVV
QTNQTQSGMNTGHTSTPHMIQQQPLQSSASQHNQQNVLSGHGQQSSLASQSQNTVSTPLY
NTMVISQPTTGNVVQVPSSLPQNNNQNAAAVTTFTQDRQIRFSQGQQLVTKLVTAPVACG
AVMVPSTMFMGQVVTAYPTFAAQQQQPQTLPVTQQQQQQQQQQSQQDQQQQQLTAVQQPA
QPQLTQHPQQFLQTSRLLHGNQSAQLILSAAFPLQQSTFTQSHHQQHQSQQQLSRHRTDK
MTDPSKAQPQ
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaccataagcacccataaaatgagctccattgcagacagaaatgatggaagc
atttttgatggtctggtggaagaagatgacaaagataaagcaaaaagagtgtccagaaac
aagtctgaaaagaaacgtcgagatcagtttaatgttcttatcaaagagctgggttccatg
cttccaggtaatgctcggaagatggataaatccactgtactacagaagagcattgacttt
ttacggaagcacaaagaaattactgcacaatcagatgccagtgagattcgacaggactgg
aaaccaacattccttagtaatgaagagttcacacagttaatgttagaggctcttgatggt
ttttttttagcaattatgacagatggaaatataatatatgtgtctgaaagtgtaactcct
ttacttgaacatttgccatctgatcttgtggatcagagcgtatttaattttatcccagag
ggggaacattcagaaatttataaaattctgtcttctcatctgctggaaagtgattcattg
acaccggaatacttaaaatcaaaaaatcagctagaattctgttgccatatgctgcgagga
acaatagacccaaaagagcaacctacatatgaatatgtaaaatttataggaaatttcaag
tgtttgaataatgttcccaattcagcacacaatggttttgaaggaactattcagcggtcg
caccggccttcatatgaagacaaagtttgctttatagccacagttagattagctacacct
caatttatcaaggaaatgtgcactgttgaagaacccaatgaagaattcacttctagacat
agcttagaatggaagttcctattcttggatcacagggcacctccaataataggctatctt
ccatttgaagttttgggaacatcaggctatgattattatcatgtggatgatctagataat
ctggcaaaatgtcatgagcatttaatgcaatatgggaaagggaagtcgtgttattacaga
ttccttacaaagggacagcaatggatttggctgcaaacacattactatatcacgtatcac
cagtggaattccaggccagagtttattgtctgtacgcacacagttgtaagttatgcagaa
gtcagagcagaaaggcggcgagaacttggttttgaggagtctcttccagagataaaagca
gataagagtcaagactctggatctgataatcacataaacacagtgagcctcaaagaagct
ctggaaaggtttgataccagccccacaccttccgcttcctccagcagttcaagaaaatct
tcacatactgcagtatcagatcattcgtcgacaccaactaagatgacagtggacactagc
actcctccaagacaaagcttatctgctcatgaaaagtctacacaaagaagatcatctctg
agcagtcagtctttaagctcccagtctcttggacaaccagtaacacagccaacgatgtct
cagcctgctactttacagctccagtccagcatgtcccagttttcagctcaattaggagct
atgcagcacctaaaagatcagctggagcagagaacacgcatgatagaggcaaatattcat
cggcagcaagaagagttgcggaaaattcaagaacagcttcagattgtccacggtcaagga
cttcagatgttcttgcagcagtcaacttctggactaaacttcagttctgtgcagcttaca
tctggaaattcttcaagtgttcagcaacttgcaccagcaaacatgcaaggtcaggttgtt
caaactaatcagactcaaagtgggatgaacacaggacatacaagtacaccacacatgatc
cagcaacagcctttgcagagctctgcatcacagcataatcaacaaaatgtacttagtgga
cacggtcaacaatcttctcttgccagtcagtcccagaacacagtctcaacacctttgtat
aacactatggtgatttctcagccaacaaccggaaatgtggttcaggttccttctagctta
ccacagaacaataaccagaatgctgctgcagtaactacttttacacaagatagacaaatc
agattttctcaaggtcagcagcttgtaacaaaacttgtcacagccccagtagcgtgtgga
gcagtaatggtaccaagtaccatgtttatgggacaggtggtgacagcttatcccactttt
gctgcccaacagcagcagccacagactttgccagtaacacagcaacagcagcagcagcag
cagcagcaaagtcagcaagaccagcagcagcagcagctcactgcagttcaacaaccagct
cagccacagctgacccagcacccgcaacagttcctacagacatccaggttacttcacggg
aatcagtcagctcagcttatcctctctgctgctttcccactacagcaaagcacttttact
cagtcccaccaccagcagcaccagtcgcagcagcagctctcacggcacagaactgacaag
atgacggatccttccaaagcgcagccacagtag

DBGET integrated database retrieval system