KEGG   Meleagris gallopavo (turkey): 100034740Help
Entry
100034740         CDS       T01523                                 

Gene name
PRKAA1
Definition
protein kinase, AMP-activated, alpha 1 catalytic subunit
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mgp04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:mgp04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:mgp04140]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:mgp04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:mgp04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Z
AA seq 539 aa AA seqDB search
YQVISTPTDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRD
LKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVIQARLYAGPEVDIWS
SGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATI
RDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECTEEEVLSCLYSRNHQDP
LAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLSRPHPERVPFLVAEAPRPRHTLD
ELNPQKSKHQGVRRAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNP
VTSAYSKMSLQLYQVDSRTYLLDFRSIDDEIIETKSGTATPQRSGSVSNYRSCQKDSDGD
AQGKSADTSLTSSMTSSLDSSTADLTPRPGSHTIEFFEMCANLILPMASFGWKRKIGEKV
SRATSQQFEAEAADEKAPGGDEDEDWVHAAKRRKEVLLEDCVKKSKQLKDEGASLAENR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
gtaccaggtcatcagtaccccaactgacattttcatggtgatggaatacgtttcaggagg
agagctgtttgactatatctgtaaaaatggaaggcttgatgagaaggaaagtagacgtct
gttccaacagatcctttctggtgtggattactgtcacaggcacatggtagttcacagaga
tctaaagcccgaaaatgtgttgcttgatgcacacatgaatgccaagatagctgactttgg
tctatcaaatatgatgtctgatggagaatttttaagaacaagctgtggttcccctaacta
tgctgcaccagaagtaattcaggccaggttatatgcaggtccagaagtagatatttggag
cagtggggttattctctatgcgttgttatgtggaacacttccattcgatgatgatcacgt
gccaacactttttaagaagatatgcgatggtatcttttatacccctcagtacctgaatcc
atctgtcattagtcttctgaaacatatgctgcaagtagatccaatgaagagagcaacaat
ccgagacattagagaacacgaatggtttaagcaggaccttcccaaatacttgtttcccga
agacccttcatatagctctaccatgattgatgatgaagccttaaaagaagtatgtgagaa
gtttgaatgtaccgaagaggaagtgctaagttgtctgtatagccgaaatcatcaggatcc
tttagcagttgcttatcacctcattatagataacagaagaataatgaacgaggccaaaga
cttctatctggctacaagcccaccagattcttttcttgatgatcaccatctgtctcgtcc
tcatccagagagagtgccattcttagtagctgaggcaccacggcctcgccatactcttga
tgagctgaatccacagaaatcaaaacaccaaggtgtaagaagagcgaagtggcacttggg
gatacggagtcagagtcgaccaaatgatataatggctgaagtctgtcgagcaattaagca
gctggattatgaatggaaggttgtaaatccatactacttgcgtgttcgaaggaagaatcc
agtgacaagtgcatattctaaaatgagtttacagctgtatcaggtggacagcagaacgta
tttgctggacttccgtagcattgatgatgaaattattgaaacgaagtctgggactgcaac
tccacagagatctggttctgtgagcaactacagatcttgtcagaaagattcagatggtga
cgcacaaggaaaatctgcagatacatcccttacctcgtcaatgacctcttcacttgattc
ttcgacagctgacttaactccaagaccaggcagtcataccatagaattttttgagatgtg
tgcaaatcttattctcccgatggcatcttttggctggaagagaaagatcggcgagaaggt
ctccagagccacttcccagcagtttgaagcagaggctgcggatgagaaggctccgggtgg
tgatgaagatgaggactgggtgcacgctgcgaagagaaggaaggaagttctcctcgaaga
ctgcgtaaagaagagcaaacagctgaaagacgagggggcaagtttggctgaaaataggag

DBGET integrated database retrieval system