KEGG   Meleagris gallopavo (turkey): 100126248Help
Entry
100126248         CDS       T01523                                 

Gene name
PRLR, tprlr
Definition
prolactin receptor
Orthology
K05081  
prolactin receptor
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100126248 (PRLR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100126248 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    100126248 (PRLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Z
AA seq 763 aa AA seqDB search
EEKIYECPDYRTSGPNSCYFNRNYTNSWTTYNITVTATNEIGSNSSDPQYVDVTSIVQPG
SPVNLTLETQRYANIMYLWAKWSPPLLADASSNHLYHYELRLKPEEKEEWETVPVGVQTQ
CKINRLNAGMRYVVQVRCMLDPGEWSEWSSERRILISGGLSPPEKPTITKCRSPEKETFT
CWWKPGLDGGHPTNYTLLYSKEGEEQVYECPDYRTAGPNSCYFDKKHTSFWTVYNITVKA
TNEMGSNSSDPHYVDVTYIVQPDPPANVTLELKKPINRKPYLMLTWSPPPLADVRSGWLT
LDYELRLKPEEGEEWETVFVGQQTQYKMFSLNPGKKYIVQIHCKPDHHGSWSEWSSENYI
EIPNDFRVKDMIVWIVLGVLSSLICLIMSWTMVLKGYRMITFILPPVPGPKIKGIDTHLL
ETGKSEELLSALGCHGFPPTSDCEELLIEYLEVEDSEDHQLMPSHDSGRPSKNAKITLKE
TDRDSGRGSCDSPSLLSEKCRETCALPSALQIQDVRDVQAKKAGKRSWESYCVASERKAL
LFNNESAKSSTLPAVQLPNNQPPTFAYHSIVEANKITLTTTNMNVAAVLVENEERHQSLY
SISETISGGMEKQEEMENLHSKTTQTTVQVRQNRSNEKLPFLNAALMDYVEVHKVRQDEE
PTVLLKHKEKSGKIEKYTISGASKEYTKVSTVMNHNILVLMPDSRVLHTPTSQEEPAKET
SQNPQQGQVETNMSYCMTAPRDCQREPSGSEYMDPSSFMPSFK
NT seq 2293 nt NT seq  +upstreamnt  +downstreamnt
tgaagaaaaaatctatgaatgtccagactacagaacatcaggtcccaattcctgctactt
caatagaaactacactaattcgtggacaacatataatatcactgtaacagcaacgaatga
gattggaagtaacagctcggatcctcagtatgtggatgtgacttccatagttcagccagg
ttctcctgtgaatctcacactagaaacacaaagatatgctaatataatgtacctgtgggc
aaaatggtctccacctctattagctgatgccagctctaatcatttatatcactatgagct
acgactaaaacctgaggaaaaggaagagtgggagacagtacctgttggagtacagacaca
gtgcaaaataaataggttaaatgctggcatgaggtatgttgttcaggtccgttgtatgtt
agaccctggagaatggagtgaatggagctctgaaagacgcattctgatttctggtggact
gtcacctcctgaaaagcctacaataaccaaatgccgctccccagaaaaggaaacatttac
ctgttggtggaaacccggtttagatggagggcatcctactaactacactttactttacag
caaagagggagaagaacaagtttatgaatgtccagattacagaactgcaggccccaattc
ctgctactttgataaaaaacacacttctttctggaccgtatacaatattactgtcaaggc
aactaatgaaatgggaagtaacagctctgatcctcattatgtggatgtgacatacatagt
acagccagatcctcctgcgaatgtaactttagaattaaaaaagccaataaacagaaaacc
atatctgatgttgacatggtctccacccccactggctgatgtcagatctggatggcttac
cctcgactatgaattgcgactgaagcctgaagaaggagaggaatgggagactgtttttgt
tggacagcaaacacaatataaaatgtttagtttaaatccaggaaagaagtacattgtaca
gattcactgcaaaccagaccaccatggatcatggagtgaatggagctcagagaactatat
tgaaattcctaatgacttcagagtaaaagatatgattgtgtggatcgtcttgggtgtctt
gtcatctctcatttgtttaatcatgagctggacaatggttttaaaagggtacaggatgat
aacttttatcctaccaccagttccaggaccaaagataaaaggcatagatacacatctgtt
agagacagggaaatctgaagaactgttgagtgcacttggttgccatggtttccctccaac
atcagactgtgaggaactactgattgagtatctggaagtagaggacagcgaagatcatca
gcttatgccaagtcatgacagtggtcgtcccagtaaaaatgcaaaaattacactcaagga
aacagacagagactcaggacgaggaagctgtgatagcccttctctgctttctgaaaagtg
cagggagacctgtgcccttccatcagcacttcaaatacaagatgtaagagatgttcaagc
aaagaaagcagggaaaaggagctgggaaagttactgtgtagcctcagaacgaaaagcact
cctttttaacaacgagagtgcaaaatcatccacattgcctgcagttcagttacctaacaa
tcagcctcctacttttgcatatcacagcattgtagaagctaacaagataacactgactac
cacaaatatgaatgttgcagcagttttggtggaaaatgaagaaaggcatcaatcactata
ttctatctctgaaaccatctctggaggcatggaaaagcaagaagaaatggaaaatttgca
ttccaaaactacgcaaaccacagtgcaggtcagacaaaacagatctaatgaaaagttacc
atttttgaatgctgcactcatggattatgtagaagttcacaaagtcagacaggatgagga
accaacagtattactgaaacataaagaaaaaagtggaaagattgaaaaatacactatttc
aggagccagcaaagaatacacgaaggtctcaacagttatgaaccataatattctagtatt
aatgccagattcacgagttctgcacacacctacatcccaagaagaacccgcaaaagaaac
gtctcagaaccctcagcaaggtcaagtggaaacaaacatgagctactgtatgacagctcc
acgtgactgccaaagagaacctagtggatcagagtacatggacccatcctcatttatgcc
ctcctttaaataa

DBGET integrated database retrieval system