KEGG   Meleagris gallopavo (turkey): 100379156Help
Entry
100379156         CDS       T01523                                 

Gene name
GPX1, Gpx-1
Definition
glutathione peroxidase 1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100379156 (GPX1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100379156 (GPX1)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100379156 (GPX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 195 aa AA seqDB search
MAATRLAGISARPLGAAEPLALGSLQGKVLLVVNVASLXGTTTRDFLQLXELQQRYGPRG
LRVLGFPCNQFGHQENATNEEILRSLEYVRPGNGFKPNFTMFEKCEVNGKGAHPLFAFLR
EALPFPHDDPSALMTNPQYIIWSPVCRNDVSWNFEKFLVGPDGVPFRRYSRHFETIKLQD
DIELLLQKVPKEALQ
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaacgcggctggcggggatctcggcgcggccgctgggcgcggctgagccgctg
gcgctgggctccctgcagggcaaagtgctgctggtggtcaacgtggcgtcgctctgaggc
accaccacgcgcgacttcctgcagctcnatgagctgcagcagcgctacgggccccgcggg
ctgcgcgtgctcggcttcccctgcaaccaattcgggcaccaggagaacgccaccaacgag
gagatcctgcgctcgctggagtacgtgcggcccggcaacggcttcaaacccaacttcacc
atgttcgagaagtgcgaggtgaacgggaagggcgcgcacccgctgttcgccttcctgaga
gaggcgctgcccttcccgcacgacgacccctcggcgctgatgaccaacccgcagtacatc
atctggtcgccggtgtgccgcaacgacgtctcctggaacttcgagaagttcctcgtgggc
cccgacggcgttcccttccgccgctacagccgacacttcgagaccatcaagctgcaggac
gacatcgagctgctgctccagaaggtgcccaaggaggctctgcaataa

DBGET integrated database retrieval system