KEGG   Meleagris gallopavo (turkey): 100379156Help
Entry
100379156         CDS       T01523                                 

Gene name
GPX1, Gpx-1
Definition
glutathione peroxidase 1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mgp00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mgp00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 195 aa AA seqDB search
MAATRLAGISARPLGAAEPLALGSLQGKVLLVVNVASLXGTTTRDFLQLXELQQRYGPRG
LRVLGFPCNQFGHQENATNEEILRSLEYVRPGNGFKPNFTMFEKCEVNGKGAHPLFAFLR
EALPFPHDDPSALMTNPQYIIWSPVCRNDVSWNFEKFLVGPDGVPFRRYSRHFETIKLQD
DIELLLQKVPKEALQ
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaacgcggctggcggggatctcggcgcggccgctgggcgcggctgagccgctg
gcgctgggctccctgcagggcaaagtgctgctggtggtcaacgtggcgtcgctctgaggc
accaccacgcgcgacttcctgcagctcnatgagctgcagcagcgctacgggccccgcggg
ctgcgcgtgctcggcttcccctgcaaccaattcgggcaccaggagaacgccaccaacgag
gagatcctgcgctcgctggagtacgtgcggcccggcaacggcttcaaacccaacttcacc
atgttcgagaagtgcgaggtgaacgggaagggcgcgcacccgctgttcgccttcctgaga
gaggcgctgcccttcccgcacgacgacccctcggcgctgatgaccaacccgcagtacatc
atctggtcgccggtgtgccgcaacgacgtctcctggaacttcgagaagttcctcgtgggc
cccgacggcgttcccttccgccgctacagccgacacttcgagaccatcaagctgcaggac
gacatcgagctgctgctccagaaggtgcccaaggaggctctgcaataa

DBGET integrated database retrieval system