KEGG   Meleagris gallopavo (turkey): 100538362Help
Entry
100538362         CDS       T01523                                 

Gene name
PDIA6
Definition
protein disulfide isomerase family A, member 6
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100538362 (PDIA6)
Enzymes [BR:mgp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100538362 (PDIA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 450 aa AA seqDB search
MVSGNADCFDSFLLGTVSCTLFLAVNGLYSASDDVIELTPTNFNKEVIQSESLWLVEFYA
PWCGHCQRLTPEWKKAATALKGVVKVGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAE
DYQGGRTSEAIVDAALSALRSLVKDRLSGRSGGYSSGRQSRESGGGDKKDVVELTDDSFD
KNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQMLASR
YGIRGFPTIKIFQKGEDPVDYDGGRTRSDIIARALDLFSDNAPPPELLEIISEDVLKTTC
DAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGI
GGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSVGRGSTAPVGGGAFPKIHAVEP
WDGKDGELPVEDDIDLSDVDLDDIWDKDEL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggtttccgggaatgctgattgttttgattcttttcttctaggcacagtgagctgcacg
ttattcctggcagtaaacggtttatattcagccagtgatgatgtgatagagctcacacca
accaacttcaacaaggaggtcattcagagtgagagcctgtggctcgtggagttctacgcc
ccatggtgtggtcattgtcaaagactaacccctgagtggaagaaagctgcaacagcatta
aaaggtgtagtgaaagtaggtgcagtagatgcagataagcatcagtccttgggtgggcag
tatggagtcagaggttttccaactatcaagatatttggagccaacaaaaacaaagcagaa
gattatcagggtggcaggacaagtgaagccattgttgatgctgctctaagtgctcttcgg
tccctggtgaaagaccgtctcagtggcagaagtggaggatacagttctgggagacagagc
cgagagagcggaggtggagataagaaggacgtggttgaactgactgatgacagcttcgat
aagaatgtcataaacagtgacgatgtgtggatggtggagttctatgccccatggtgtggg
cactgcaaaaatctggagccagaatgggcagctgctgccactgaggtgaaggaacaaacc
aaggggaaagtcaagctggctgcagtagatgcaacagtcaatcagatgctggcaagccga
tatgggattcgtggttttcccacaattaaaatattccagaaaggagaagaccctgttgat
tatgatggaggaagaactaggtctgatatcattgctcgtgctctggatctcttttctgat
aatgcaccaccacctgagctcctggagattattagtgaagatgttctgaagactacctgt
gatgctcatcagctctgcatcatttctgtcctgcctcatattcttgacacaggagcctcg
gggaggaattcttacctggatgtcatgttaaaaatggctgagaaatacaaaaagaaaatg
tgggggtggctgtggaccgaagctggcgctcagtcagatcttgagagctctttgggaata
ggaggctttgggtatccagcaatggcagctgttaatgcccggaagatgaaatttgccctc
ctgaaaggatccttcagtgaacaagggattaatgagtttctaagggaactgtctgttggt
cgtggttctacagcaccagtaggaggtggagcttttcctaaaattcatgcagttgaacct
tgggatggcaaagatggtgagcttccagttgaagatgatattgatctcagcgatgttgat
ctggatgatatctgggataaagatgagctgtga

DBGET integrated database retrieval system