KEGG   Meleagris gallopavo (turkey): 100538384Help
Entry
100538384         CDS       T01523                                 

Definition
protein disulfide-isomerase A3-like
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100538384
Enzymes [BR:mgp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100538384
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100538384
  Exosomal proteins of colorectal cancer cells
   100538384
  Exosomal proteins of bladder cancer cells
   100538384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 456 aa AA seqDB search
MRCSSRRLKRQERSDTEGCGMGVCCWLGGARVDCTANSNTCNKYGVSGYPTLKIFRDGEE
SGTYDGPRTADGIVSHLKKQAGPASVALGSLADFEKFIGDKDASVVGFFRDASGDAHSEF
MKAANNLRDNYRFAHTSEEQLVQKYEEDGEGVVLFRPSRLANKFEESTVKYTEDKITSAK
IKKFIQENIFGICPHMTEDNKDLIQGKDLLVAYYDVDYEKNAKGSNYWRNRVMMIAKKFL
DAGHKLSFAVASRKTFGHELSEFGLDNSVGEAPVVAIRTAKGDKYVMQEEFSRDGKALER
FLQDYFDGNLKKYLKSEPVPENNDGPVKVVVAENFDEIVNAEDKDVLIEFYAPWCGHCKN
LEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFAPAGKKQSPKKYEGGR
EVSDFISYLKREATSTPVLQEEDKAKKSKKKAKEDL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgcagttctcggagactcaagcgtcaggaacggtctgatactgagggctgcggg
atgggcgtgtgctgctggctggggggggctcgggttgactgtacagcaaattcaaacacc
tgcaacaagtatggagtcagtggatatcccaccctgaagatttttcgagatggagaagag
tcaggaacctatgatggacccaggacagcagatggaattgtcagtcatctcaagaaacag
gcaggacctgcttcagtggctctcggttccctggctgattttgagaaattcattggtgat
aaagatgcttctgtagtgggcttctttagagatgcttctggcgacgctcattctgaattc
atgaaagctgccaacaacttaagagacaactaccgttttgcacacaccagtgaggagcag
ttggtgcagaagtacgaggaagatggagagggtgtggtcctgttccgaccttcacggctg
gcaaacaagtttgaggagagcactgtcaagtacactgaagacaaaatcaccagtgcaaag
atcaagaagtttatccaggagaatatctttggtatctgtccacatatgactgaagacaac
aaagacttgatccaagggaaggatttgctggtggcgtactacgatgtggattatgagaag
aatgcaaagggctccaactactggcgcaaccgagttatgatgattgcaaagaagttcttg
gatgctggtcacaaactgtcatttgctgtggccagccggaaaacttttggccacgagctg
tcagaattcggtctagacaacagcgtgggtgaggctcctgttgttgccatcagaacagct
aaaggagataaatatgtcatgcaggaagaattctcccgtgatggaaaggctctggagaga
ttcttgcaagattactttgatggcaacttgaaaaagtacctgaaatcagagcctgtgcct
gaaaacaatgatggccctgtgaaggtggtggttgctgagaactttgatgaaattgttaat
gcagaagacaaagatgtcctgatagagttttatgcaccctggtgtggccattgcaagaat
ctggagcccaaatacaaggagttgggagagaagctcagtaaagaccccaatattgtcatt
gccaaaatggatgctacagccaacgatgtgccttctccatatgaagtcagaggcttcccc
accatctattttgctccagctggcaagaagcaaagtccaaagaagtatgagggtggcaga
gaagtgagtgacttcatcagctacttgaagcgggaggcaaccagcactcctgtgctgcag
gaggaagataaagccaagaaatccaagaagaaggcgaaggaggatttgtaa

DBGET integrated database retrieval system