KEGG   Meleagris gallopavo (turkey): 100538384Help
Entry
100538384         CDS       T01523                                 

Gene name
PDIA3
Definition
protein disulfide isomerase family A, member 3
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100538384 (PDIA3)
Enzymes [BR:mgp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100538384 (PDIA3)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100538384 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   100538384 (PDIA3)
  Exosomal proteins of bladder cancer cells
   100538384 (PDIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 455 aa AA seqDB search
MAFSSLLFASAVAETFTVDKMLRILNMSIPVDCTANSNTCNKYGVSGYPTLKIFRDGEES
GTYDGPRTADGIVSHLKKQAGPASVALGSLADFEKFIGDKDASVVGFFRDASGDAHSEFM
KAANNLRDNYRFAHTSEEQLVQKYEEDGEGVVLFRPSRLANKFEESTVKYTEDKITSAKI
KKFIQENIFGICPHMTEDNKDLIQGKDLLVAYYDVDYEKNAKGSNYWRNRVMMIAKKFLD
AGHKLSFAVASRKTFGHELSEFGLDNSVGEAPVVAIRTAKGDKYVMQEEFSRDGKALERF
LQDYFDGNLKKYLKSEPVPENNDGPVKVVVAENFDEIVNAEDKDVLIEFYAPWCGHCKNL
EPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFAPAGKKQSPKKYEGGRE
VSDFISYLKREATSTPVLQEEDKAKKSKKKAKEDL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggctttctccagtcttttgtttgcttcagctgttgccgaaaccttcactgttgataag
atgctaagaattcttaacatgtcgattcctgttgactgtacagcaaattcaaacacctgc
aacaagtatggagtcagtggatatcccaccctgaagatttttcgagatggagaagagtca
ggaacctatgatggacccaggacagcagatggaattgtcagtcatctcaagaaacaggca
ggacctgcttcagtggctctcggttccctggctgattttgagaaattcattggtgataaa
gatgcttctgtagtgggcttctttagagatgcttctggcgacgctcattctgaattcatg
aaagctgccaacaacttaagagacaactaccgttttgcacacaccagtgaggagcagttg
gtgcagaagtacgaggaagatggagagggtgtggtcctgttccgaccttcacggctggca
aacaagtttgaggagagcactgtcaagtacactgaagacaaaatcaccagtgcaaagatc
aagaagtttatccaggagaatatctttggtatctgtccacatatgactgaagacaacaaa
gacttgatccaagggaaggatttgctggtggcgtactacgatgtggattatgagaagaat
gcaaagggctccaactactggcgcaaccgagttatgatgattgcaaagaagttcttggat
gctggtcacaaactgtcatttgctgtggccagccggaaaacttttggccacgagctgtca
gaattcggtctagacaacagcgtgggtgaggctcctgttgttgccatcagaacagctaaa
ggagataaatatgtcatgcaggaagaattctcccgtgatggaaaggctctggagagattc
ttgcaagattactttgatggcaacttgaaaaagtacctgaaatcagagcctgtgcctgaa
aacaatgatggccctgtgaaggtggtggttgctgagaactttgatgaaattgttaatgca
gaagacaaagatgtcctgatagagttttatgcaccctggtgtggccattgcaagaatctg
gagcccaaatacaaggagttgggagagaagctcagtaaagaccccaatattgtcattgcc
aaaatggatgctacagccaacgatgtgccttctccatatgaagtcagaggcttccccacc
atctattttgctccagctggcaagaagcaaagtccaaagaagtatgagggtggcagagaa
gtgagtgacttcatcagctacttgaagcgggaggcaaccagcactcctgtgctgcaggag
gaagataaagccaagaaatccaagaagaaggcgaaggaggatttgtaa

DBGET integrated database retrieval system