KEGG   Meleagris gallopavo (turkey): 100538384Help
Entry
100538384         CDS       T01523                                 

Definition
protein disulfide-isomerase A3-like
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mgp04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 456 aa AA seqDB search
MRCSSRRLKRQERSDTEGCGMGVCCWLGGARVDCTANSNTCNKYGVSGYPTLKIFRDGEE
SGTYDGPRTADGIVSHLKKQAGPASVALGSLADFEKFIGDKDASVVGFFRDASGDAHSEF
MKAANNLRDNYRFAHTSEEQLVQKYEEDGEGVVLFRPSRLANKFEESTVKYTEDKITSAK
IKKFIQENIFGICPHMTEDNKDLIQGKDLLVAYYDVDYEKNAKGSNYWRNRVMMIAKKFL
DAGHKLSFAVASRKTFGHELSEFGLDNSVGEAPVVAIRTAKGDKYVMQEEFSRDGKALER
FLQDYFDGNLKKYLKSEPVPENNDGPVKVVVAENFDEIVNAEDKDVLIEFYAPWCGHCKN
LEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFAPAGKKQSPKKYEGGR
EVSDFISYLKREATSTPVLQEEDKAKKSKKKAKEDL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgcagttctcggagactcaagcgtcaggaacggtctgatactgagggctgcggg
atgggcgtgtgctgctggctggggggggctcgggttgactgtacagcaaattcaaacacc
tgcaacaagtatggagtcagtggatatcccaccctgaagatttttcgagatggagaagag
tcaggaacctatgatggacccaggacagcagatggaattgtcagtcatctcaagaaacag
gcaggacctgcttcagtggctctcggttccctggctgattttgagaaattcattggtgat
aaagatgcttctgtagtgggcttctttagagatgcttctggcgacgctcattctgaattc
atgaaagctgccaacaacttaagagacaactaccgttttgcacacaccagtgaggagcag
ttggtgcagaagtacgaggaagatggagagggtgtggtcctgttccgaccttcacggctg
gcaaacaagtttgaggagagcactgtcaagtacactgaagacaaaatcaccagtgcaaag
atcaagaagtttatccaggagaatatctttggtatctgtccacatatgactgaagacaac
aaagacttgatccaagggaaggatttgctggtggcgtactacgatgtggattatgagaag
aatgcaaagggctccaactactggcgcaaccgagttatgatgattgcaaagaagttcttg
gatgctggtcacaaactgtcatttgctgtggccagccggaaaacttttggccacgagctg
tcagaattcggtctagacaacagcgtgggtgaggctcctgttgttgccatcagaacagct
aaaggagataaatatgtcatgcaggaagaattctcccgtgatggaaaggctctggagaga
ttcttgcaagattactttgatggcaacttgaaaaagtacctgaaatcagagcctgtgcct
gaaaacaatgatggccctgtgaaggtggtggttgctgagaactttgatgaaattgttaat
gcagaagacaaagatgtcctgatagagttttatgcaccctggtgtggccattgcaagaat
ctggagcccaaatacaaggagttgggagagaagctcagtaaagaccccaatattgtcatt
gccaaaatggatgctacagccaacgatgtgccttctccatatgaagtcagaggcttcccc
accatctattttgctccagctggcaagaagcaaagtccaaagaagtatgagggtggcaga
gaagtgagtgacttcatcagctacttgaagcgggaggcaaccagcactcctgtgctgcag
gaggaagataaagccaagaaatccaagaagaaggcgaaggaggatttgtaa

DBGET integrated database retrieval system