KEGG   Meleagris gallopavo (turkey): 100538439Help
Entry
100538439         CDS       T01523                                 

Definition
d-amino-acid oxidase-like
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mgp00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mgp00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:mgp00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:mgp04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
17
AA seq 343 aa AA seqDB search
MRIAVIGAGVIGLSTALCIHDRFHALVPQLQLEVYADRFTPHTTSDGAAGLWQPYLSDHG
NLQETLWNKETFEHLLGYLNLPEAKEMGLFLISGYNLFKQPVPDPSWKNIVLGFRNLTPK
ELELFPGYSYGWFNTALMLECRSYLPWLTNRLAQRGVKFFHRKVESFEEMFSQGIDVVIN
CTGIRAGELQPDPALQPARGQVIKVLAPWVKHFIITHDMESGIYSSPYIIPGSELTVLGG
IYQQGNWNEENSAQDHKSIWERCCRLLPTLQKAEIVQEWSGLRPARPSVRLERESIGHGR
LRTEVIHNYGHGGFGITIHWGCAMATARLLGNILQEKQSQSRL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgctgtcatcggggctggagtgatcggcctgtccaccgccctgtgcatccat
gaccgcttccatgcactggtgccccagctgcagctggaggtctatgccgaccgcttcacg
ccgcacaccaccagcgatggggctgcaggcctgtggcagccctacctgagtgaccacggc
aatctgcaggagacgctgtggaacaaggagacctttgagcacctcctggggtacctcaac
ttgccagaagcgaaggaaatgggactgttcttgatttctggatacaacctgtttaagcag
cctgtaccggatccatcttggaagaacattgtccttggcttcaggaacttgacaccgaaa
gaacttgaactctttcctggctacagctatggctggttcaacacggcactgatgttggag
tgcaggagctatttgccctggctgaccaacaggctggcacagagaggcgtgaagttcttc
cacaggaaggtcgagtccttcgaggagatgttttcccagggaattgatgttgtcataaac
tgcactggcatccgtgctggggagctgcagccagacccagctctgcagcctgcccgtggg
caagtcatcaaggtcctggccccatgggtgaagcacttcattatcactcatgacatggag
tcagggatctacagctcaccctacatcataccggggagtgagctcacagttttgggaggc
atctaccagcaaggcaactggaacgaagagaacagtgctcaggaccacaagtccatctgg
gagaggtgctgcaggctgctgcccacgctgcagaaagcagagattgtgcaggagtggagt
ggcttgagaccagcacgtcccagtgtccgcctggagcgggagagcattggccatgggcgt
ttgaggacagaggtcatacacaactacggccacggtggctttgggatcaccatccactgg
ggctgtgccatggccacagcccggctgctcgggaacatcctgcaagagaagcagtcccag
tcccgcctgtga

DBGET integrated database retrieval system