KEGG   Meleagris gallopavo (turkey): 100538455Help
Entry
100538455         CDS       T01523                                 

Definition
steroid 21-hydroxylase-like
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mgp00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 412 aa AA seqDB search
VVVLSSAAAIREALARRWGDFVGRPTVTWRPWYHGGGQDLALGDASPEWRRQRGATRGAL
ARAVRHLEPLLELQGWALCQELSSYGAAPVDLFEAFAFHTCSTICRLAFGDLMPPEAEVR
SFTRCVVELLEVWGWASVRALDVLPPLRVLPNPGLRELLRLVERRDAFVETQIRWHQGCA
SPPGDTVLGALLGGDPTVPMGPLGGDRLHMALVDLFIGGTETTAAALLWAVAFLLHHPQV
QDRVRAELHQVLGPTGTPKPGDMGRLPLLRATVTETLRLRPPAPLALPHCARRHSSIAGI
PVPAGSIIIPNLFAAHHDPKIWDRPDEFLPERFLQPGAPWRALLPFGCGARSCVGEALAR
AELFVFLGYILQRFRLEPPSDGALPHLGVTAGTVLRCAPFRVRLVPCPPHSS
NT seq 1241 nt NT seq  +upstreamnt  +downstreamnt
aggtggtggtgctgagctctgcagccgccatccgtgaggcgttggcacggcgctgggggg
acttcgtgggacgccccacagttacctggcgtccttggtatcacgggggggggcaggacc
tggcgctgggggatgcatccccagagtggcgacggcagcggggggcaacacgaggagcac
tggcgcgggctgtgagacacctggagcccctcctggagctgcagggctgggcgctgtgcc
aggagctgagctcttacggggctgccccagtggacctctttgaggcattcgcgttccaca
cctgcagcaccatctgccgcctcgccttcggggacctgatgccccctgaggcagaggtgc
gctcctttacacgctgtgtggtggaactgctggaggtgtggggctgggccagcgtgcggg
cattggatgtgctgcctccactaagggtgctgcccaacccggggctgcgggagctgctgc
gcctggtggagcgccgcgacgccttcgtggagacccagatccgatggcaccagggctgcg
catccccccccggggacacagtgctgggggcactgctggggggggaccccactgtcccta
tggggccactggggggggaccgcctgcacatggcccttgtggacctcttcatcggtggca
ccgaaacgacagcggcagctctgctgtgggctgtggccttcctgctgcaccacccccagg
tgcaggaccgggtgcgtgcagagctgcaccaggtgctgggccccacggggaccccaaagc
caggggacatgggacgactgccactgctccgtgctaccgtcaccgagacccttcgcctgc
gtccccctgcgcctctcgcgctgccccactgcgcccggcgccactccagcattgcaggaa
ttccagtgcccgcgggatccatcattatcccaaacctcttcgctgcgcaccacgacccca
agatatgggaccgtcctgatgagttcctacccgagcggttcctgcaaccaggggccccct
ggcgagcgctgctgccctttggttgtggggcacgctcgtgtgtgggggaggcattggctc
gggcagagctctttgtgtttttggggtacatcctacagcgattccgcctggagccgcctt
ctgatggggctctgccccacttgggggtcaccgccggcaccgtgctgcgctgcgccccgt
tccgtgtgcgcctcgtgccctgcccaccccatagctcctga

DBGET integrated database retrieval system