KEGG   Meleagris gallopavo (turkey): 100538455Help
Entry
100538455         CDS       T01523                                 

Definition
steroid 21-hydroxylase-like
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100538455
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     100538455
Cytochrome P450 [BR:mgp00199]
 Cytochrome P450, animal type
  CYP21 family
   100538455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 412 aa AA seqDB search
VVVLSSAAAIREALARRWGDFVGRPTVTWRPWYHGGGQDLALGDASPEWRRQRGATRGAL
ARAVRHLEPLLELQGWALCQELSSYGAAPVDLFEAFAFHTCSTICRLAFGDLMPPEAEVR
SFTRCVVELLEVWGWASVRALDVLPPLRVLPNPGLRELLRLVERRDAFVETQIRWHQGCA
SPPGDTVLGALLGGDPTVPMGPLGGDRLHMALVDLFIGGTETTAAALLWAVAFLLHHPQV
QDRVRAELHQVLGPTGTPKPGDMGRLPLLRATVTETLRLRPPAPLALPHCARRHSSIAGI
PVPAGSIIIPNLFAAHHDPKIWDRPDEFLPERFLQPGAPWRALLPFGCGARSCVGEALAR
AELFVFLGYILQRFRLEPPSDGALPHLGVTAGTVLRCAPFRVRLVPCPPHSS
NT seq 1241 nt NT seq  +upstreamnt  +downstreamnt
aggtggtggtgctgagctctgcagccgccatccgtgaggcgttggcacggcgctgggggg
acttcgtgggacgccccacagttacctggcgtccttggtatcacgggggggggcaggacc
tggcgctgggggatgcatccccagagtggcgacggcagcggggggcaacacgaggagcac
tggcgcgggctgtgagacacctggagcccctcctggagctgcagggctgggcgctgtgcc
aggagctgagctcttacggggctgccccagtggacctctttgaggcattcgcgttccaca
cctgcagcaccatctgccgcctcgccttcggggacctgatgccccctgaggcagaggtgc
gctcctttacacgctgtgtggtggaactgctggaggtgtggggctgggccagcgtgcggg
cattggatgtgctgcctccactaagggtgctgcccaacccggggctgcgggagctgctgc
gcctggtggagcgccgcgacgccttcgtggagacccagatccgatggcaccagggctgcg
catccccccccggggacacagtgctgggggcactgctggggggggaccccactgtcccta
tggggccactggggggggaccgcctgcacatggcccttgtggacctcttcatcggtggca
ccgaaacgacagcggcagctctgctgtgggctgtggccttcctgctgcaccacccccagg
tgcaggaccgggtgcgtgcagagctgcaccaggtgctgggccccacggggaccccaaagc
caggggacatgggacgactgccactgctccgtgctaccgtcaccgagacccttcgcctgc
gtccccctgcgcctctcgcgctgccccactgcgcccggcgccactccagcattgcaggaa
ttccagtgcccgcgggatccatcattatcccaaacctcttcgctgcgcaccacgacccca
agatatgggaccgtcctgatgagttcctacccgagcggttcctgcaaccaggggccccct
ggcgagcgctgctgccctttggttgtggggcacgctcgtgtgtgggggaggcattggctc
gggcagagctctttgtgtttttggggtacatcctacagcgattccgcctggagccgcctt
ctgatggggctctgccccacttgggggtcaccgccggcaccgtgctgcgctgcgccccgt
tccgtgtgcgcctcgtgccctgcccaccccatagctcctga

DBGET integrated database retrieval system