KEGG   Meleagris gallopavo (turkey): 100538455Help
Entry
100538455         CDS       T01523                                 

Definition
(RefSeq) steroid 21-hydroxylase
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100538455
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     100538455
Cytochrome P450 [BR:mgp00199]
 Cytochrome P450, animal type
  CYP21 family
   100538455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
18
AA seq 471 aa AA seqDB search
MAVVMLLLLLLLALIWGGSTRRGQTLTSHFSPHPWFQGPHGGPFPPTHSFLAPPSPPPEV
VVLSSAAAIREALARRWGDFVGRPHSYLASLVSRGGQDLALGDASPEWRRQRGATRGALA
RAVRHLEPLLELQGWALCQELSSYGAAPVDLFEAFAFHTCSTICRLAFGDLMPPEAEVRS
FTRCVVELLEVWGWASVRALDVLPPLRVLPNPGLRELLRLVERRDAFVETQIRWHQGCAS
PPGDTVLGALLGGDPTVPMGPLGGDRLHMALVDLFIGGTETTAAALLWAVAFLLHHPQVQ
DRVRAELHQVLGPTGTPKPGDMGRLPLLRATVTETLRLRPPAPLALPHCARRHSSIAGIP
VPAGSIIIPNLFAAHHDPKIWDRPDEFLPERFLQPGAPWRALLPFGCGARSCVGEALARA
ELFVFLGYILQRFRLEPPSDGALPHLGVTAGTVLRCAPFRVRLVPCPPHSS
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggtgatgcttctgctgctgcttctcctggccctgatctggggggggtcaacc
aggcggggacaaactttaacctctcacttctccccacacccctggtttcaaggtccccat
gggggtcccttccctccaacccactcatttcttgcccccccctccccccccccagaggtg
gtggtgctgagctctgcagccgccatccgtgaggcgttggcacggcgctggggggacttc
gtgggacgcccccacagttacctggcgtccttggtatcacggggggggcaggacctggcg
ctgggggatgcatccccagagtggcgacggcagcggggggcaacacgaggagcactggcg
cgggctgtgagacacctggagcccctcctggagctgcagggctgggcgctgtgccaggag
ctgagctcttacggggctgccccagtggacctctttgaggcattcgcgttccacacctgc
agcaccatctgccgcctcgccttcggggacctgatgccccctgaggcagaggtgcgctcc
tttacacgctgtgtggtggaactgctggaggtgtggggctgggccagcgtgcgggcattg
gatgtgctgcctccactaagggtgctgcccaacccggggctgcgggagctgctgcgcctg
gtggagcgccgcgacgccttcgtggagacccagatccgatggcaccagggctgcgcatcc
ccccccggggacacagtgctgggggcactgctggggggggaccccactgtccctatgggg
ccactggggggggaccgcctgcacatggcccttgtggacctcttcatcggtggcaccgaa
acgacagcggcagctctgctgtgggctgtggccttcctgctgcaccacccccaggtgcag
gaccgggtgcgtgcagagctgcaccaggtgctgggccccacggggaccccaaagccaggg
gacatgggacgactgccactgctccgtgctaccgtcaccgagacccttcgcctgcgtccc
cctgcgcctctcgcgctgccccactgcgcccggcgccactccagcattgcaggaattcca
gtgcccgcgggatccatcattatcccaaacctcttcgctgcgcaccacgaccccaagata
tgggaccgtcctgatgagttcctacccgagcggttcctgcaaccaggggccccctggcga
gcgctgctgccctttggttgtggggcacgctcgtgtgtgggggaggcattggctcgggca
gagctctttgtgtttttggggtacatcctacagcgattccgcctggagccgccttctgat
ggggctctgccccacttgggggtcaccgccggcaccgtgctgcgctgcgccccgttccgt
gtgcgcctcgtgccctgcccaccccatagctcctga

DBGET integrated database retrieval system