KEGG   Meleagris gallopavo (turkey): 100538462Help
Entry
100538462         CDS       T01523                                 

Definition
tyrosinase-like
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100538462
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    100538462
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100538462
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     100538462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 537 aa AA seqDB search
MLSCRSVRMSLFAMCLLLAILQPSAGQFPRVCANTQSLLRKECCPPWDGDGSPCGERSNR
GTCQRILLSQAPLGPQFPFSGVDDREDWPSVFYNRTCRCRGNFMGFNCGECKFGFSGQNC
TERRLRTRRNIFQLTVSEKDKFLAYLNLAKNIPSKDYVIATGTYAQMNNGSNPMFRNINV
YDLFVWMHYYASRDTLLGGSNVWRDIDFAHEAPGFLPWHRAFLLLWEREIQKITGDENFT
IPYWDWRDAEDCVICTNEYMGGQHPTNPNLLSPASFFSSWQVICTRSEEYNSQQALCNAT
SEGPILRNPGNNDKSRTPRLPSSSEVEFCLSLTQYESGSMDKMANYSFRNTLEGFADPRT
AISNISQSGLHNALHIYMNGSMSQVQGSANDPIFILHHAFVDSIFERWLRRHRPMLEAYP
AANAPIGHNRENYMVPFIPLYRNGEFFIPSRELGYDYEYLQEPALGSFQDFLIPYLEQAR
QLWPWLVGAAVIGGVVTAVLSGLILACRKKRAGTSPEIQPLLTESEDYNNISYQSHF
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgctctcctgccgctctgtgaggatgtctctgtttgccatgtgcttactgctggccatc
cttcagccgtccgctgggcagttccccagagtctgtgcgaacacacaaagcttgctgagg
aaggagtgctgtcctccctgggatggcgatgggtccccttgcggggagcgttccaacaga
ggaacctgccagcgcatccttctctctcaggctcctctgggaccacagttccctttctca
ggagtggatgacagagaggattggccttctgtgttttacaaccggacatgcagatgcaga
ggcaatttcatggggttcaactgtggggagtgcaagtttggcttctcgggacaaaactgc
actgaaaggcgactcagaacgagaagaaacatcttccagctcaccgtcagtgagaaggac
aagttccttgcctaccttaacctagcaaagaatatccctagcaaggactatgtcattgct
actggcacatacgctcagatgaacaacggctccaatcccatgttcagaaatatcaacgtg
tatgatctcttcgtctggatgcattattatgcctctcgagacacacttttaggtggctcc
aatgtgtggagggacattgattttgcccatgaagctcctggttttctgccttggcatcgt
gcttttctgctgctgtgggaacgtgagatacagaagataacaggtgatgagaacttcacc
atcccctactgggactggcgagatgcagaggactgtgtgatctgcactaatgaatacatg
ggtggccaacaccccaccaaccctaatttactcagcccagcatcatttttctcctcgtgg
caggtaatctgcactcgatctgaagagtacaacagccagcaggctttatgcaatgccact
agtgaagggcctatacttcgaaatcctggaaacaatgacaaatcaaggaccccaaggctc
ccatcttcatcagaagtcgaattttgtctgtcactcactcagtatgaatctggatccatg
gataaaatggccaattatagcttccgaaacactttggaaggctttgctgatccacgcact
gcaatatcaaacatatctcaaagtggtttgcataatgcccttcacatctacatgaatggc
tccatgtcccaagtacaaggctctgcaaatgatcctatcttcatcctacaccatgctttt
gttgacagcatttttgagcgatggttaagaagacacagacccatgctagaagcttaccca
gcagccaatgcacccattgggcacaatcgagaaaattatatggttccctttatccctctc
tacagaaatggagaattttttataccatcaagggagctggggtatgactatgagtatctg
caagaaccagcacttggttctttccaggactttttaatcccctatcttgagcaagcccgt
cagctctggccctggctggttggcgcagctgtgatcggaggcgtagttactgctgtgctc
tctgggctcatcctggcctgcaggaagaaaagagcaggaacttctccagaaatacaaccc
ttactcacagaaagtgaggattacaacaatatatcttatcaatcccatttctga

DBGET integrated database retrieval system