KEGG   Meleagris gallopavo (turkey): 100538588Help
Entry
100538588         CDS       T01523                                 

Definition
cytochrome P450 4B1-like
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100538588
Cytochrome P450 [BR:mgp00199]
 Cytochrome P450, animal type
  CYP4 family
   100538588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 504 aa AA seqDB search
MVSLLDNIARPSAIILQLSVVLGVIFVLLKVVKFYQQRKKILKALEAFPGPPAHWLYGHN
HLITGDKMLSLVVSLGEQYPYAFPRWFGPVLPSLVIHHPEYAKTILGRGDPKPPVPYHFL
VPWIGKGLLVLGGTKWFQHRKLLTPAFHYDVLKSYVSLMSESVKVMLDKWEKKKSVELFE
DVSLMALDSIMKCAFSYNTNCQTQSNSDTYIKAVFDLGSLINKRIQNFSYHDAFYDLSRS
SREFQDACRRAHAHTDKVIQERKILLSNDKELDKILKKRHLDFLDILLCTKDENGVGLSD
EDLRAEVDTFMFEGHDTTASGISWLLYSMALHPEHQARCREEIRGIVGKRDTIEWEDLGK
MTYSTMCIKESLRLFPPVPAVSRRLSKPVTFSDGRSLPEGSQVSLNIFGIHRNRDVWEDP
EVFDPLRFSPENSAHRHSHAFLPFSAGPRNCIGQQFAMNEIKVALALTLLRFELFPNASK
PPTLTQQLILKSSSGIHLHLKKIH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctctcctggacaacatagccagaccttctgctatcattctgcagctgtctgtg
gtgcttggtgtcatctttgtcctactgaaggtggtcaaattctaccagcagaggaagaag
atcctcaaagctctggaagcatttcctggtcccccagcgcattggctttatggccacaac
catctgataactggtgataaaatgttaagtctggtagtgtcactgggagaacaataccca
tatgcctttcccagatggtttggaccagtgctgccatctctagtaatccaccatcctgaa
tatgccaagactattcttggacgaggagatcccaagcctcctgtaccttatcacttctta
gttccatggatcggcaaagggttgctggtcttgggtggaaccaaatggtttcagcatcgg
aagttgctcactccagcgtttcattatgatgtgctgaaatcttatgtgtccctgatgtca
gaatcggtcaaagtgatgctggataaatgggagaagaagaagtcagtagagctctttgaa
gacgtcagcctgatggcactggacagcatcatgaaatgtgccttcagctacaacaccaac
tgccagactcagagcaactcagatacttatatcaaagccgttttcgacctgggctccctc
ataaacaagagaatacagaatttctcctaccacgatgccttctatgacctgagtcgcagc
agcagggagtttcaggatgcctgcagacgggcccatgcccacacagataaagtaatacaa
gaaagaaagatactgctctccaatgacaaggagctagacaagatcctgaagaagagacac
ctggattttctggacattcttctttgtaccaaggatgagaatggagttggcctgtctgat
gaggacctgcgtgccgaggtggacacattcatgtttgaggggcacgacactacagccagc
gggatttcatggctcctgtacagcatggcattgcaccccgagcaccaggcacggtgcagg
gaggagatccgggggatcgtggggaaacgggataccattgagtgggaggacctggggaag
atgacatacagcaccatgtgcatcaaggagagcttgcgcctgttcccaccagtccctgca
gtgtcccgaaggctctctaaacctgtcacgttttctgatgggcgcagcttacctgaaggc
tcccaagtttcgttgaacatattcggtattcacaggaaccgggatgtgtgggaagatccc
gaggtatttgatcccctgaggttttctcctgagaactcagcacataggcattcgcacgct
ttcctgcctttctctgcaggacccaggaactgcattgggcagcagtttgctatgaatgag
ataaaggtggctctggcactgaccctgctccgcttcgagctgtttcccaatgcctccaag
cctcctacactgacacagcagctcatcctcaagtccagcagcggcatccacctgcatttg
aaaaagattcactga

DBGET integrated database retrieval system