KEGG   Meleagris gallopavo (turkey): 100538592Help
Entry
100538592         CDS       T01523                                 

Gene name
KCNMB1
Definition
(RefSeq) potassium large conductance calcium-activated channel, subfamily M, beta member 1
  KO
K04937  
potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    100538592 (KCNMB1)
Ion channels [BR:mgp04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   100538592 (KCNMB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
15
AA seq 268 aa AA seqDB search
MSSATVKQTQRSIGKKKKHLHQLYAPLLYGVTPFCPSLSHNRSCPSTSKGSISSETEQRD
SRLPNTYIMLAKKLVTAQKRGETRALCLGLGMVACSMMMYFFIGITIVPFYTKSVWTTET
ICKVLKANIKDKTLCPNSESSEDEDIFHYPCLQVWVNLTASGQEVMLYHTEDTLERNPKC
SYVPGNSENSKEVKARIETIANNLKKYQTFPCYYDPGGMQTNVILSRLYPPKGLLFTFLW
PTLMFTGGCLIIVLVKISQYVSVLSARQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggccacagtaaagcaaacccagagaagcataggaaagaaaaaaaaacacctc
caccagctctacgctccactgctttatggtgtaacacctttctgcccaagtctgtcacat
aaccggagttgtccttccaccagcaaaggcagcatttcatcagaaacagaacagagagat
tccagacttcctaacacctacatcatgttggcaaaaaagctggtgactgcacagaagcga
ggagagacgagggccctatgtctgggactgggaatggtcgcatgctccatgatgatgtac
ttctttattgggattacaatcgtgccattctacactaaaagtgtttggacaacagaaacc
atatgcaaggtcctcaaagccaacatcaaggacaaaaccctctgcccaaacagcgaaagc
tcagaggatgaagatatctttcactacccttgcctacaggtgtgggttaatctgacagcc
tcaggacaagaggtcatgttgtatcacactgaagataccctggaaagaaatccaaagtgc
tcgtatgtccccggcaactccgagaactccaaagaagtgaaagcacgaatagaaacaatt
gcaaacaatttgaaaaaatatcagactttcccatgctactacgacccaggaggaatgcag
accaatgtcattttaagcagactttatccccccaaaggcctcctcttcactttcctttgg
cccacactcatgtttaccggtggatgtctgattattgtcctggtaaagatcagccagtat
gtttctgttctttctgctcggcagtag

DBGET integrated database retrieval system