KEGG   Meleagris gallopavo (turkey): 100538592Help
Entry
100538592         CDS       T01523                                 

Definition
putative calcium-activated potassium channel subunit beta-like
Orthology
K04937  
potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Vascular smooth muscle contraction
Class
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:mgp04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 200 aa AA seqDB search
MLAKKLVTAQKRGETRALCLGLGMVACSMMMYFFIGITIVPFYTKSVWTTETICKVLKAN
IKDKTLCPNSESSEDEDIFHYPCLQVWVNLTASGQEVMLYHTEDTLERNPKCSYVPGNSE
NSKEVKARIETIANNLKKYQTFPCYYDPGGMQTNVILSRLYPPKGLLFTFLWPTLMFTGG
CLIIVLVKISQYVSVLSARQ
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgttggcaaaaaagctggtgactgcacagaagcgaggagagacgagggccctatgtctg
ggactgggaatggtcgcatgctccatgatgatgtacttctttattgggattacaatcgtg
ccattctacactaaaagtgtttggacaacagaaaccatatgcaaggtcctcaaagccaac
atcaaggacaaaaccctctgcccaaacagcgaaagctcagaggatgaagatatctttcac
tacccttgcctacaggtgtgggttaatctgacagcctcaggacaagaggtcatgttgtat
cacactgaagataccctggaaagaaatccaaagtgctcgtatgtccccggcaactccgag
aactccaaagaagtgaaagcacgaatagaaacaattgcaaacaatttgaaaaaatatcag
actttcccatgctactacgacccaggaggaatgcagaccaatgtcattttaagcagactt
tatccccccaaaggcctcctcttcactttcctttggcccacactcatgtttaccggtgga
tgtctgattattgtcctggtaaagatcagccagtatgtttctgttctttctgctcggcag
tag

DBGET integrated database retrieval system