KEGG   Meleagris gallopavo (turkey): 100538749Help
Entry
100538749         CDS       T01523                                 

Gene name
USP30
Definition
(RefSeq) ubiquitin specific peptidase 30
  KO
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    100538749 (USP30)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100538749 (USP30)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100538749 (USP30)
Ubiquitin system [BR:mgp04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100538749 (USP30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
17
AA seq 496 aa AA seqDB search
MASLPAPPALLPHRVNRNHVISIPNSLTSESSKVCAACTVSALPSLLAGLVPGLLNLGNT
CFMNSLLQGLSSCPSFIRWLEEFTAQYKAEQNQPSEQQYLSLTLLHLLRALSCQEVTEDD
VLDASCLLEVLRIYRWQISTFEEQDAHELFHVLTSSLEDERDRQPRVTHLFDVHSLEQPE
ITQKQISCRTRGSLPPMSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRYDTFDSLSLSIPA
AMWGHPMTLDHCLHHFISSESVKDVVCDNCTKIQAEGTLNGQSIENQKTTFVKQLKLGKL
PQCLCIHLQRLSWSNQGTPLKRHEHVQFNEFLIMDIYKYHIPVHKSTQNDLNQKSSEETK
PGTRDGISVKPSDAEQTRGTKSLLMNGACSSSLLMSSGTFPLTAFPECSPPVYLYRLMAV
VVHHGDMHSGHFVTYRRSPPSSKSPLSVSNQWLWISDDTVRKASLQEVLSSSAYLLFYER
VHSRVQHQSLELRPEE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacttccggcgccccccgcgctacttccgcaccgagtaaacagaaatcatgta
atttccataccaaattcacttaccagtgaaagtagtaaggtttgtgcagcctgcacggtg
tcagctcttccatctctgttggcaggcctggtgcctggcctgctgaacctcggaaacacc
tgcttcatgaactccctgctgcaaggcctgtcttcgtgcccctcgttcatcaggtggctg
gaggagttcacagcacagtacaaggcagaacagaaccaacccagcgagcagcagtacttg
tcgctcactctgttgcatctcctaagagctttatcctgtcaagaggtaacagaagatgat
gtcctggatgcaagctgcttattagaagtgttaagaatttacaggtggcagatctcgaca
tttgaagagcaggatgctcatgaactatttcatgtccttacctcttcattggaagatgaa
cgggatcgtcagccacgtgtcacacatttgtttgatgtgcattcactggagcagccagaa
ataacccaaaagcaaataagctgccgaacaagaggatctcttcctcctatgtcaaatcac
tggaagtctcagcatccttttcatggaaggctgaccagcaacatggtttgcaaacactgt
gaacaccagagtcctgtgaggtatgatacatttgacagcctctcactgagtattccagca
gctatgtggggtcatcctatgacactggatcactgcctccatcacttcatctcctctgaa
tctgtgaaggatgttgtgtgtgacaattgcactaaaattcaggcggaagggactctgaat
ggacagagcatagaaaaccagaaaacaacatttgttaagcaattaaagctagggaagctc
cctcagtgtttgtgtatccatctgcaaagactgagctggtccaaccaagggactcctctg
aaacgtcacgaacacgtacagttcaatgagttcctaatcatggacatctacaaataccac
attcctgttcataaatcaactcagaacgatctgaatcagaaaagctccgaagagacaaag
cctggaacaagggatgggatatcagtaaaaccttcagatgcagaacagacacgtggtacc
aaatctctccttatgaatggggcctgctcttcttcactcttaatgtcctcgggaactttt
ccactcactgcattccctgaatgcagtccccccgtgtacctgtaccggctgatggcggtg
gttgtgcaccatggagacatgcattctggacactttgtgacttaccgccgctctccgcct
tcttccaagagcccgctctctgtcagcaatcagtggttatggatttcagatgacactgtt
cgcaaagctagtttgcaggaggtcctttcctctagtgcttacctgctgttctatgagcgc
gttcactcaagggtacagcaccagagtttggagttgaggcctgaagagtga

DBGET integrated database retrieval system