KEGG   Meleagris gallopavo (turkey): 100538755Help
Entry
100538755         CDS       T01523                                 

Definition
mRNA export factor-like
Orthology
K14298  
mRNA export factor
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
RNA transport
Influenza A
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100538755
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100538755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 309 aa AA seqDB search
MTHFSKVRCWEVQDNGQTIPKAQQMHTGPVLDGCWSDDGSKVFTASCDKTAKMWDLNSNQ
AIQIAQHEAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSPTPMMTLQLPERCYCADVV
HPMAAVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKVNKPTGFALGSIEGR
VAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSF
WDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAA
EELKPRNKK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgactcattttagtaaggttcgctgctgggaggttcaggataacggacagacgattcca
aaggctcagcagatgcacacagggcctgtactggatggctgctggagtgatgatggaagt
aaagtatttactgcttcctgtgataaaacggccaaaatgtgggatctcaacagtaatcag
gctattcagattgcacaacatgaagctcctgtgaagaccatccattggattaaagcacca
aattacagctgtgtgatgacaggaagctgggataaaactttgaagttctgggatacccgt
tcaccaacgcctatgatgacactgcagctccctgaaagatgttactgtgcagatgtggtt
catcctatggctgctgtggccaccgcagaaaggggtttgatagtttatcagttagagaac
cagccatctgaatttagaagaatagaatcacctcttaaacaccagcatcgctgcgttgct
atttttaaagacaaagtgaacaaacctactggatttgcccttggaagtattgaaggaaga
gtagctattcattatatcaaccctccaaatcctgcaaaagataatttcactttcaaatgt
catcgctccaatggaacaaacacatcagcacctcaggatatctatgctgtaaatggaata
gcattccatcctgtccatggcactcttgcaacagtgggatctgatggtagattcagcttt
tgggataaagatgcacgaacaaagctaaaaacatcagaacaacttgaccaaccaatatct
gcttgttgtttcaaccataatgggaatatatttgcatatgcctccagttatgattggtca
aagggtcatgaattttataatccacaaaagaaaaactacatttttctgcgaaatgcagca
gaagagttaaagcctcggaataagaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system