KEGG   Meleagris gallopavo (turkey): 100538755Help
Entry
100538755         CDS       T01523                                 

Gene name
RAE1
Definition
(RefSeq) ribonucleic acid export 1
  KO
K14298  
mRNA export factor
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100538755 (RAE1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100538755 (RAE1)
Messenger RNA biogenesis [BR:mgp03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100538755 (RAE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
22
AA seq 368 aa AA seqDB search
MSLFGSTSGFGTGGTSMFGSTTADNHNPMKDIEVTSPPDDSISCLAFSPPTLPGNFLIAG
SWANDVRCWEVQDNGQTIPKAQQMHTGPVLDGCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHEAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSPTPMMTLQLPERCYCADVVH
PMAAVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKVNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgttcggctccacgtccgggttcggtaccggcggtaccagcatgttcggcagc
acgactgcggataaccacaacccgatgaaggatattgaggtaacatctccgcccgacgac
agcatatcttgtttagcgttcagtccaccaacactgccgggcaatttccttattgcagga
tcgtgggcaaacgatgttcgctgctgggaggttcaggataacggacagacgattccaaag
gctcagcagatgcacacagggcctgtactggatggctgctggagtgatgatggaagtaaa
gtatttactgcttcctgtgataaaacggccaaaatgtgggatctcaacagtaatcaggct
attcagattgcacaacatgaagctcctgtgaagaccatccattggattaaagcaccaaat
tacagctgtgtgatgacaggaagctgggataaaactttgaagttctgggatacccgttca
ccaacgcctatgatgacactgcagctccctgaaagatgttactgtgcagatgtggttcat
cctatggctgctgtggccaccgcagaaaggggtttgatagtttatcagttagagaaccag
ccatctgaatttagaagaatagaatcacctcttaaacaccagcatcgctgcgttgctatt
tttaaagacaaagtgaacaaacctactggatttgcccttggaagtattgaaggaagagta
gctattcattatatcaaccctccaaatcctgcaaaagataatttcactttcaaatgtcat
cgctccaatggaacaaacacatcagcacctcaggatatctatgctgtaaatggaatagca
ttccatcctgtccatggcactcttgcaacagtgggatctgatggtagattcagcttttgg
gataaagatgcacgaacaaagctaaaaacatcagaacaacttgaccaaccaatatctgct
tgttgtttcaaccataatgggaatatatttgcatatgcctccagttatgattggtcaaag
ggtcatgaattttataatccacaaaagaaaaactacatttttctgcgaaatgcagcagaa
gagttaaagcctcggaataagaagtag

DBGET integrated database retrieval system