KEGG   Meleagris gallopavo (turkey): 100538949Help
Entry
100538949         CDS       T01523                                 

Gene name
USP3
Definition
ubiquitin specific peptidase 3
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100538949 (USP3)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100538949 (USP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 444 aa AA seqDB search
MAVHEVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQIPMTNHKKTEKQEKVQHTVC
MDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTSDRHRKRKLLENSSLNSK
LLKVNGSTTALCATGLRNLGNTCFMNAILQSLSNIQQFCCYFKELPAVELRNGKTAGRRT
YHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFM
RYLLDHLHLELQGGFNGVSRSVILQENSSLTASSKCCINGASTVVTAIFGGILQNEVNCL
ICGTESRKFDPFLDLSLDIPSQFRNKRTKNQENGPMCTLRGCGHVTDDCLLLLLKNCPSL
KTLKLENCARITDRTLEAAILYGGSLQTLHVDFCRNITQSGLERVKEKRPSVTLRAERSA
NMIPDSKPEKKLAFEKLSRKMALL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcagtccatgaagtgtgccggtcaaataaaagcccgtgggtctgtctgacgtgctcc
agtgtccattgtggaagatatgtgaatggccacgccaaaaagcattatgaagatgcacag
attcctatgaccaatcataagaaaacagaaaaacaagaaaaagttcagcatactgtgtgt
atggattgcagtagttacagtacatactgttaccgctgtgatgactttgttgtgaatgat
accaagctggggctggtgcagaaggtcagagagcatctacagaacttggaaaattcagcc
tttacatcagacagacacaggaaaagaaaactattggaaaactcatctctgaacagcaag
ttactaaaagtaaatggaagcaccactgccctctgtgccacaggccttcggaacctgggg
aacacgtgtttcatgaatgcgatccttcagtcgctcagtaacattcagcagttttgctgt
tacttcaaagaattgcctgctgtggagctgaggaatgggaagacagcaggcaggagaact
taccataccaggagccagggagataacaatgtttcattggtggaagaattcagaaagaca
ctttgtgctttatggcaaggaagccaaactgcatttagtccagaatccttattttatgtt
gtttggaaaattatgccaaattttaggggataccagcaacaggatgcccacgagttcatg
cgttaccttctggaccatctacacctggaactccagggtggctttaatggtgtttcacgt
tcagtaattttgcaagaaaattctagcctgactgcgagcagcaaatgttgcataaatgga
gcctctactgttgtcacagccatttttggaggcattcttcaaaatgaagtcaactgctta
atatgtggaacagaatctagaaaatttgacccattcctagatctttcgctagatattcca
agtcagttcagaaataaacgtactaaaaatcaagaaaatggaccaatgtgcacactacga
ggatgcggccatgttacagacgattgccttttgcttctcctcaagaactgcccaagcctc
aagacactcaaactggaaaactgcgcgcggatcactgaccggacgctagaagcagcaatc
ctctatgggggatcactgcaaacgttgcacgtggatttctgccggaacataacacagagc
gggctggagagagttaaggaaaaacggccctcagtaacactgagagcagagagaagtgct
aacatgattccagacagtaagccggaaaaaaagttggcgtttgaaaaactgtccagaaaa
atggctctgctttaa

DBGET integrated database retrieval system