KEGG   Meleagris gallopavo (turkey): 100538961Help
Entry
100538961         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase 2-like
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100538961
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100538961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
26
AA seq 549 aa AA seqDB search
MSQLSSTLKRYVDSSRYAENTYSKMPSGYSSYTSYGSTYAYADRDKIGFKSSYLPSSRYH
HSRLSPTSGYDSGRLPLYPDSSIRLSPAYIRTQPGGGLSGGSCYSFTGTPSSPSGYVSTS
TLLSRRRAISHSDLAQEFSGLHTSDSAYASSPSALYQAATRSDYVRDYLEKSSYCSLPSS
PSSSQLCERDDGHGSTHGPDPMSSKVVQGLTGLRNLGNTCFMNSILQCLSNTKELRDYCL
QNQYLRDLNNNSRMRTALMSEFAKLIQLLWTSSPNDSVSPSEFKTQIQRYAPRFVGYNQQ
DAQEFLRFLLDGLHSEVNRVLVRPRANADTLDHLPDDEKSRQMWRRYQEREDSRVSDLFV
GQLKSSLTCSECGYCSTAFDPFWDLSLPIPKKGYGEVTLMDCLRLFTKEDVLDGDEKPTC
CRCKARTRCTKKFSIQKFPKILVLHLKRFSEARIRASKLSTFVNFPLKDLDLREFASQSC
NHAVYNLYAVSNHSGTTMGGHYTAYCKSPISSEWHSFNDSRVTPMSSSHVRSSDAYLLFY
ELASPSSRM
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagctctcctccacactgaaacggtacgttgactcgtcccgctatgccgagaac
acctacagcaagatgcccagcggctacagctcctacacctcctacggctccacctatgcc
tatgcagacagagacaaaatcggcttcaaatccagctacctgccctcctctcggtaccac
cacagcagactgtccccaaccagcggctacgacagcggccgcctgcccctgtaccccgac
tccagcatccgcctgagccctgcctacatccgcacacagccgggcggggggctgagcggg
ggctcgtgctactccttcaccgggacccccagcagcccctctggctatgtgtccacctcc
acacttctcagccgtcgcagagccatcagccactcggacctggcacaggagttttcaggg
ctgcacacttcggatagcgcctacgcatccagccccagtgctctgtaccaggctgccacg
cgctctgactacgtccgcgattacctggagaagagcagctactgcagcctgccctccagc
ccctccagcagccagctctgtgaaagggatgatggtcatggcagcacgcatggccccgac
cccatgagctccaaggtggtgcaggggctgactggactgcggaacctcggcaatacgtgc
ttcatgaactccatcctgcagtgcctgagtaacaccaaggagctgcgggattactgcctg
cagaaccagtacctgcgggacctcaacaacaacagccgcatgcgcactgcgctcatgtca
gagttcgcaaagctgatccagctgctctggacctcatcccccaatgacagcgtgagcccc
tccgagttcaagacgcagatccagagatatgccccacgctttgttggatacaaccagcag
gatgcacaggagttcctgcgtttcctcctagatgggctgcatagcgaggtgaaccgtgtg
ctggtgcggccgcgggccaacgctgacaccctggaccacctccctgatgatgagaagagc
cgccagatgtggcggaggtaccaggagcgggaggacagccgtgttagtgatctcttcgtt
gggcagctgaagagctcgctgacctgcagtgagtgcggctactgctccacagcctttgac
cccttctgggacctctccttgcccatccccaagaaaggctacggggaagtcaccctgatg
gactgcctgcggctcttcaccaaagaggacgttctggatggggatgagaaaccgacgtgt
tgtcgctgcaaagccaggacgcggtgcacgaagaaattcagcatccagaagttccccaag
atcctggtgctccacctgaaacgcttctcagaggccaggatacgagccagcaagctctcc
accttcgtcaacttcccactgaaggacctggacctgagggagttcgcctcacagagctgc
aaccacgccgtttacaacctctacgccgtctccaaccactcgggcaccaccatgggggga
cactacactgcctactgcaagagccccatctccagcgagtggcacagcttcaatgattcc
cgcgtcaccccgatgtcctccagccacgtacgcagcagcgatgcctacctgctcttttac
gagctggccagcccatcctcacgcatgtag

DBGET integrated database retrieval system