KEGG   Meleagris gallopavo (turkey): 100539027Help
Entry
100539027         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase 34-like
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 2243 aa AA seqDB search
MVFVSLGAPRRERKGDGVQLPASCLPPPQKDNIPMLLLLQEPHLTTLFDLLEMLASFKPP
SGEASMEDTESAKCEELHLHAENLSRRVWELLMLLPTCPNMLQAFQNISDEQGNDGFSWK
DLLRIKSAHKLLYALEIIEALGKPNRRIRRESTGSYSDLYPDSDDSSEDQIENSKNTWSC
KFVAAGGLQQLLEIFNSGILEPKERESWTVWQLDCLACLLKLICQFAVDPSDLDLAYHDV
FAWSGVAESHRKRTWPGKSRKAASDHVKGLHIPRLTEVFLVLVQGTSLIQRLMSVAYTYD
NLAPRVLKAQSDHRSRHEVTHYSMWLLVSWAHCCSSVKSSLADSDYLQDWLKKLTLLIPE
TAVRHESCNGLYKLSLSGLDGGDSINRSFLLLAASTLLKFLPDAQSLKPIQIEDYEEEPV
LRPGCKEYFWLLCKLIDNIHVKDASQTTLLDLDALARHLADCIRSREILDHQDGNIEDDG
LTGLLRLATSVIKHKPPFKFSREGQEFLRDIFNLLFLLPSLKDRQQPKCKSHSSRAAAYD
LLVEMVKGSVENYRLLHNWVMAQHMQSSHAPYKWDYWPHDDVRAECRFVGLTNLGATCYL
ASTIQQLYMIPEARQAIFTAKYSEDMKHKTTLLELQKMFTYLMESECKAYNPRPFCKTYT
MDKQPLNTGEQKDMTEFFTDLITKIEEMSPELKNTVKSLFGGVITNNVVSLDCEHVSQTA
EEFYTVRCQVADMKNIYESLDEVTIKDTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILS
FNTMRYTFNMVTMMKEKVNTHFSFPLRLDMTPYTEDFLMGKNDRKEGFKEDGEYLKETES
YEYDLIGVTVHTGTADGGHYYSFIRDIVNPHAYKNNKWYLFNDAEVKPFDSTQLASECFG
GEMTTKTYDSVTDKFMDFSFEKTHSAYMLFYKRMELEEENGKDYKFDVSSELLEWIWHDN
MQFLQDKNIFEHTYFGFMWHLCSSIPSTLPDPKAVSLMTAKLSTSFVLETFIHSKEKPTM
LQWIELLTKQFNNSQAACEWFLDRMADDDWWPMQILIKCPNQIVRQMFQRLCIHVIQRLR
PVHAHLYLQPGIEDCSDDMDGPVEDIGSRSCVTRFVKTLLSIMEHGVKPHSKHLTEYFAF
LYEFAKMGEEESQFLLSLQAISTMVHFYMGTKGPENPQVEVLSEEEGEEEEEEEDILSLA
EEKYRPAALEKMIALIALLVEQSRSERHLTLSQNDMAALTGGKGFPFLFQHIRDGINIRQ
TCNLIFSLCRYNNRLAEHIVSMLFTSIAKLTPEAANPFFKLLTMLMEFAGGPPGMPPFAS
YILQRIWEVIEYNPSQCLDWLAVQTPRNKLAHSWVLQNMENWVERFLLAHNYPRVRTSAA
YLLVSLIPSNSFRQMFRSTRSLHIPTRDLPLSPDTTVVLHQVYNVLLGLLSRAKLYVDAA
VHGTTKLVPYFSFMTYCLISKTEKLMFSTYFMDLWNLFQPKLSEPAIATNHNKQALLSFW
YNVCVDCPENVRLIVQNPVVTKNIAFNYILADHDDQDVVLFNRGMLPAYYGILRLCCEQS
PAFTRQLASHQNIQWAFKNLTPHASQYPGAVEELFNLMQLFVAQRPDMREEEIEDIKQFK
KTTISCYLRCLDGRSCWTTLISAFRILLESDEDRLLVVFNRGLILMTESFNTLHMMYHEA
TACHVTGDLVELLSIFLSVLKSTRPYLQRKDVKQALIQWQERIEFAHKLLTLLNSYSPPE
LRNACIDVLKELVLLSPHDFLHTLVPFLQHNHCTYHHSNIPMSLGPYFPCRENLKLIGGK
SNIRPPRPELNMCLLPTMVEASKGKDDVYDRMLLDYFFSYHQFIHLLCRVAISCEKFTET
LVKMSVLVAYEGLPLHLALFPKLWTELCQTQSAMSKNSVKLLCEDPVFAEYIKCILMDER
TFLNNNIVYTFLTHFLLKVQGQVFSEANCANLINTLITNLINQYQSLESDFSSQRVEISK
ASSALNGDLRALALLLSVHTPKQLNSALIPTLQELLNKCRACQQQRNSLQEQEAKERKIK
DDEEATPVKRRRVSSDEEHTVDSCISDIKTEPQEALTPTSTSDNETRDSSIIDPGTEQDL
PSPENNSVKEYRMEVPSSFSEDIMLTMRSQHTEEQSGNGKFQECKEFKDLQTSKDSVAAE
EDSEFPSTSISAVLSDLTDLRGCDSQALSSQDPETSLSITCGHSRGLFSLMQQHDILDIL
CRTIESTIHVVTRISGKGNQAAS
NT seq 6732 nt NT seq  +upstreamnt  +downstreamnt
atggtatttgtatccctgggagcaccaaggagagaacgtaaaggtgatggtgtacagctt
ccagcatcttgcctaccccctcctcaaaaggacaacattccaatgcttttactcttgcaa
gaacctcatcttactactctttttgatctgttggagatgctagcctcctttaaacctcct
tctggagaagcatctatggaagatactgagagtgcaaaatgtgaagaactccatctccac
gcagaaaacttatcgagacgtgtttgggaactgttaatgcttctaccaacatgccctaat
atgttgcaggcattccagaatatttcagatgaacagggtaatgatggcttcagctggaag
gatcttttgcgaataaaaagtgcccataaacttttgtatgccttggaaattattgaagct
ctgggaaagcccaacagaagaataagacgtgaatctacgggaagttatagtgatctttat
ccagactcagatgattcaagtgaagatcaaatagaaaatagtaaaaacacatggagctgc
aagtttgttgcggctggagggctccaacaattactagaaatttttaattctggaatctta
gagcctaaagaacgagagtcatggactgtgtggcaactggactgccttgcttgcttgctg
aagctgatatgccagtttgcagttgatccttcagatctggatttagcttaccatgatgtc
tttgcctggtctggtgtagcagagagtcacagaaaaagaacatggcctggcaaatcaagg
aaggctgcaagtgaccatgtgaagggccttcacatacctcgcttaacagaggtgtttctt
gtacttgtccagggaaccagtctgattcagcgacttatgtcagttgcttatacgtatgac
aacttggcacccagggtgttgaaagctcagtctgatcacagatcaagacatgaagtcaca
cattactcaatgtggctcttggtgagttgggctcactgctgttcctcagtgaaatcaagt
ctggcagacagtgattatttgcaagactggctaaagaaacttaccctccttattccagag
actgctgttcgtcatgagtcatgcaatggtttatacaagttatctctttctggtctcgac
ggaggagactcaattaatcggtcctttctgctgctggctgcatcaacattattaaaattt
cttcctgatgctcaatctctgaaacctatccagattgaggactatgaagaagaaccagtg
ctacgaccaggttgtaaggaatatttttggctgttgtgcaaactgatcgataacatacat
gtcaaagatgcaagtcagaccacgctgcttgatctagatgcactagcaagacatcttgct
gactgcattcggagcagagaaatccttgaccatcaagatggcaatatagaagatgatgga
cttacaggactgcttcgtctcgctacaagtgttattaagcacaagccaccctttaagttt
tctcgtgaagggcaggagttcctgagagacatcttcaatcttttgttcttgctgccaagt
ttaaaagacagacaacagccaaaatgcaagtcacattcttcaagggctgctgcatacgac
ttactggtagaaatggtaaaggggtccgttgaaaactacaggctactccacaactgggtt
atggcacaacatatgcagtcctcccatgcaccttacaagtgggattattggccgcatgat
gatgttcgagctgaatgtcgatttgtgggtctgactaatttaggagcaacctgttacttg
gcatcgactattcagcagctatatatgataccagaagccagacaagcaatctttactgca
aagtattcagaagatatgaaacacaagactactctactagaactccagaaaatgtttaca
tacttaatggaaagtgaatgtaaagcgtataatccacggcccttttgtaaaacttatacc
atggataagcagccattgaacactggagagcagaaagatatgactgagttcttcactgac
ctgatcacaaaaatagaagagatgtctccagaactgaaaaacacagtgaaaagtttgttt
ggaggtgttattacaaacaatgttgtttccttggattgtgaacatgtaagtcagactgct
gaagaattctatacagtaagatgccaggtagcagatatgaagaatatttacgaatctctt
gatgaagtaactattaaagataccttggaaggtgacaacatgtatacatgttctcattgt
gggaaaaaagtgcgggctgaaaaaagggcatgttttaagaaactacctcgtatcttaagc
ttcaacactatgagatatacatttaatatggtaactatgatgaaggagaaagtgaacact
catttttcattccctctgcgtttggatatgacaccttatactgaagatttcctcatggga
aaaaatgacaggaaagaaggttttaaggaagacggtgaatatttgaaagaaactgagagt
tatgagtatgatctcatcggtgtaacagttcatacaggaacagcagatggtggacactat
tatagtttcatcagagatatagtaaatccccacgcttacaaaaacaacaaatggtatctt
ttcaacgatgctgaagtaaaaccatttgattcaacgcagcttgcctcagaatgttttggt
ggagaaatgactacaaaaacatatgattctgttactgataaatttatggacttctccttt
gaaaagacacacagtgcttacatgctgttttataaacggatggagctggaagaggaaaat
ggcaaagactacaaatttgatgtttcttcggagttgctggagtggatatggcatgataac
atgcagtttcttcaagacaagaacatttttgaacatacatattttgggtttatgtggcat
ttgtgtagtagcatcccaagcacgctaccagatccaaaagcagtttccctgatgacagca
aagttaagcacttcttttgtactagagacatttattcattcaaaagaaaagcctacaatg
cttcagtggattgaacttttaacaaagcagtttaataacagtcaggcagcttgtgaatgg
tttttggatcgtatggcagatgatgattggtggccaatgcagattctaataaagtgtccc
aatcagattgtgagacagatgttccaacgtttgtgcattcacgtgatacagagactgaga
ccagtgcatgcacatctttatcttcagccagggatagaagactgttcggatgacatggat
ggtcccgtggaagacatcggcagtcgctcttgtgtaacacgttttgtgaagactctcttg
tctattatggagcatggtgttaagccacacagtaaacacctcacagaatactttgccttt
ctttatgaatttgccaaaatgggtgaagaggaaagccaattcttgctttcactgcaagcc
atatcaacaatggttcatttctacatgggaactaaaggacctgaaaatccacaggttgaa
gtactttctgaggaagaaggggaggaggaggaggaggaggaagatatactttctttagca
gaagaaaaatacaggcctgctgctcttgagaagatgattgctctgattgctctcctagtt
gaacagtctcgctctgaaaggcatttgactttatcacagaatgacatggcagcattaaca
ggaggaaagggttttccttttttgtttcaacatatccgtgatggtatcaacatcaggcaa
acttgcaatctcatcttcagtttgtgtcggtacaataacagacttgcagaacatattgtg
tccatgcttttcacatcaatagcaaagttgactcctgaggcagccaatccttttttcaaa
ttgttgactatgctaatggaatttgctggtggacccccaggaatgccaccttttgcttct
tacattctgcagaggatttgggaggtcattgaatacaacccatctcagtgcctggattgg
ctggctgtgcaaacacctcgaaataaactagcacacagctgggtgctacaaaacatggaa
aactgggttgaacgttttcttttggcacataactatcctagagtgagaacttctgcagcc
tatctcttggtgtcgcttattccaagcaattccttccgtcagatgttccgatcaacccgc
tctttgcacatccctacacgtgatctgcctcttagtccagatactacagtagttcttcat
caagtctacaatgtgcttcttggccttctttcaagagctaagttatatgttgatgctgct
gttcatggcacaacaaaactcgtgccctatttcagttttatgacatactgcttgatctca
aaaactgagaaactcatgttttctacttacttcatggatttatggaaccttttccagcct
aaactttctgagccagctatagccaccaaccacaataaacaggctttgttgtctttttgg
tataacgtctgtgttgactgtccagagaatgtgcgccttattgtacagaaccctgtggtg
acaaagaacattgccttcaattacatccttgctgaccacgatgatcaggatgtagtgctc
ttcaaccgtgggatgctgcctgcctactatggcatcctgcgtctctgctgtgagcagtcc
cctgcgttcacgaggcagttggcttctcaccagaacatccagtgggccttcaagaatctc
acaccacatgccagtcagtacccaggagcagtcgaagaactgtttaacctcatgcaactt
tttgtagctcagagaccagacatgagagaggaggagatagaagacataaagcagtttaag
aaaaccaccataagctgttatctgcgctgcttggatggacgatcttgttggactacttta
ataagtgccttcagaatattattggagtctgatgaagacaggcttcttgttgtgtttaac
agaggattgattctgatgactgagtcatttaacacattacacatgatgtaccacgaggct
acagcttgccacgtgactggagacctggtagaacttctgtctatattcctttcagttctt
aaatcgacacgtccatatcttcaaagaaaagatgtgaagcaagctctcattcagtggcag
gagcgaattgaatttgcccataaacttttaactttgctaaattcctacagtcctccagaa
cttagaaatgcttgtattgatgtcctcaaggagcttgtacttttaagtcctcatgatttc
ctacatactctggttccatttctacagcacaatcattgtacataccaccacagtaatatc
ccaatgtctcttggaccttattttccatgtcgtgaaaacttgaaattaatagggggaaaa
agcaatattcgtcctccacgtcctgagctcaatatgtgcctcttgcctactatggtagaa
gccagcaagggaaaagatgatgtttatgatcgtatgctgctagactacttcttttcttat
catcaattcatccatctactatgccgagttgcaatcagctgtgaaaagtttactgaaaca
ttagttaaaatgagtgttcttgttgcatatgaaggtttaccacttcatcttgcattattc
cccaaactttggactgagctttgtcagactcagtctgcaatgtcaaagaacagtgtaaag
ctcctctgtgaagatccagtttttgcagaatatataaaatgtattttaatggatgaaagg
actttccttaacaacaacattgtatacacctttttgacgcattttcttcttaaggtccaa
gggcaggtgttttctgaagcaaactgtgccaatttaatcaatactctgattacaaatcta
ataaatcagtatcaaagcctagaatctgatttcagcagccagagagttgaaatctccaaa
gcaagctctgctttaaatggggacctccgagcacttgccttgctgctttcagtgcatact
cctaaacagctcaattcagccctgattccgactttacaagaacttttaaacaagtgtaga
gcatgtcaacaacagaggaattcactacaagaacaagaagccaaagaaagaaaaattaaa
gatgatgaagaagctactcctgtaaaaagaagacgggtcagcagtgatgaggagcacacc
gtagacagttgtatcagtgatataaaaactgaaccccaggaagcattgaccccaacaagc
acttcagataatgagacacgggactcttcgatcattgatccaggcactgaacaagatctt
ccttcccctgaaaataattctgtcaaagagtacagaatggaagttccatcttcattttca
gaagacataatgctgacaatgaggtcacaacatacagaagagcagtcaggaaatggtaaa
tttcaagaatgcaaagaatttaaagacctgcagacttccaaggattccgttgcagcagag
gaggactcggagtttccttccacatcaatttcagcagttttatctgacctcacagatttg
agaggctgtgatagtcaagccttatcatcccaggaccctgaaactagtttatcaatcact
tgtggccattccagaggactttttagtcttatgcagcagcatgacattttagacatcctg
tgtaggaccattgagtctacaattcatgtggttacaaggatatctggaaaaggaaatcaa
gctgcttcttga

DBGET integrated database retrieval system