KEGG   Meleagris gallopavo (turkey): 100539052Help
Entry
100539052         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase 33-like
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100539052
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100539052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 910 aa AA seqDB search
MASLSSNCPHLESVGEITKEELIQKSHGTCQDCKVRGPNLWACLENRCTYVGCGESHVDH
STTHSQETKHCLTVNLTTLRVWCYACSKEVFLDRKLGCHSPLPNARLTQTLENSVQDFKI
PSVPTLKIPLSAVFDDLDIEVEEDELKTRGLTGLKNIGNTCYMNAALQALSNCPPLTHFF
LDCGGLARTDKKPAICKSYLKLMTELWHKNRPGSVVPTGLFQGIKSVNPTFRGYSQQDAQ
EFLRCLMDLLHEELKEPIVEVEDAQATSVEESMEVDKSQSDAGLQPCESCGTCDKIENDA
VFKPALEDPAETTMLIQDDENNSIISKDWQKEKISSNKLNRANSMEDLEKNTNSTSEANE
FLNNQGTVKVQIHSRFSEYINDVHMNDVSGAQTLSSNEGMNTRLSSSPPKSCTSCSASTP
IHKKVSTVSSPKRKKCKKYRSVISDIFDGTIVSSVQCLTCDRLSVTLETFQDLSLPIPGK
EDLAKLHSASHQTSLVKTGSCGEAYAPQGWIAFFMEYFKRFVVSCVPSWFWGPVVTLQDC
LAAFFARDELKGDNMYSCGRCKKLRNGVKFCKVQKFPEILCIHLKRFRHELMFSTKIGTH
VSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSGHYIAYCRNNLNNLWYEFDDQ
SVTEVSESTVQNAEAYVLFYRKCNEEAQRERRRISSLLNMMEPSLLQFYISRQWLNKFKT
FAEPGPISNNDFLCMHGGVPPHKASFIEDLVLMLPQNIWDNLYSRYGGGPAVNHLYVCHT
CQIESERLEKRRKNELEMFIRLYRAFQEEESSSTFYCISMQWFREWEGFVKGKDSDPPGP
IDNAKIAITKCGNAVLKQGADSGQISEETWNFLQSIYGGGPEIIHRPPAPTVEPDILQTE
EKIELETHCL
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggcatcactcagcagcaattgcccacacctggaatcggttggcgagataacaaaagag
gaattgatacagaagtctcatggcacttgtcaggactgtaaagttagaggacccaacctt
tgggcatgcttggagaacagatgcacgtatgttggctgtggtgaatcccatgtcgatcac
agtaccacccattcccaggagacaaaacactgtctaactgtcaaccttactacgctccgt
gtttggtgttatgcctgtagtaaggaagtgttcctggatagaaaattaggatgtcattct
ccattgccgaatgcaagactgactcaaacactagaaaatagtgtgcaggattttaaaata
cccagtgttcccacactgaagattccattatcagcagtatttgatgaccttgatatagaa
gtggaagaagatgagttaaagactagaggtctaacaggattaaaaaatattggtaacact
tgttacatgaatgcagctttacaggctctttccaactgcccacctttgacacatttcttt
cttgactgtggaggcttagcccgaacagataaaaaaccagcaatttgtaaaagttacctc
aagctgatgacagaactctggcacaaaaacaggcctggttctgttgttccaactggctta
tttcaaggaattaaaagtgttaatccaacttttcgaggctactctcaacaggatgcacaa
gaatttttgcgttgcctaatggatttgcttcatgaagaacttaaagaacccattgtggaa
gttgaagatgcacaggctacaagtgttgaagagagtatggaagtagacaagagccagtca
gatgcaggccttcagccgtgtgaatcctgtggtacctgtgataaaatagaaaatgatgct
gttttcaaacctgccttggaggatcctgcagagacaaccatgttaattcaggatgatgag
aacaactcaatcatatccaaagactggcagaaagaaaaaatatcaagcaacaaacttaac
agggcaaattcaatggaagatttggaaaagaacacaaacagtacttcagaagcaaatgaa
tttttaaataatcaaggaactgtcaaagtacagatacacagcagattctcagaatacatc
aatgatgtccacatgaatgatgtatctggagcccaaaccctgtcatcaaatgaagggatg
aacacacgcctgtcaagcagtcctccaaaatcatgcacatcatgctctgcatcgacacca
atccacaaaaaagtctcaactgtatcatcaccaaagaggaagaagtgcaagaagtacagg
agtgttatctctgatatatttgatgggactatagtaagctcggtacagtgcttgacttgt
gatcggttgtctgtaaccttggagacttttcaggatctgtccttgccaattccaggtaag
gaagatcttgctaaactccattctgcaagtcatcagacatctctagtcaaaacagggtcg
tgtggagaagcatatgccccccagggctggatagctttttttatggaatatttcaaaagg
tttgttgtctcatgtgttcctagctggttttggggtccagttgtaaccttacaagattgt
cttgctgcctttttcgccagagatgagctgaagggtgataacatgtacagctgtggaagg
tgtaaaaagttaagaaatggagtgaaattctgcaaagtgcaaaaatttcctgagatattg
tgcattcatctcaaaagatttagacatgaacttatgttttccacaaaaattggaacccat
gtgtcctttccattggaaggccttgatcttcagcctttccttgcgaaggacagtccagct
cagatagtgacttatgatctcctatctgtcatctgccatcatggaactgccagcagtgga
cattatatagcttattgtcgaaacaatttaaataatttgtggtatgaatttgatgaccaa
agtgtcacagaggtttcagagtccacggtgcaaaatgcagaagcctatgtgctcttctat
agaaagtgtaatgaagaagctcaacgagagagacggagaatatcaagtctactgaatatg
atggaaccaagtcttctgcaattctatatttcaagacagtggttaaataaattcaagact
tttgcagagccaggaccaatttcaaataatgacttcctttgtatgcacggaggtgttcct
ccccacaaagctagcttcatagaggacctggttttaatgcttcctcaaaatatatgggat
aatctgtatagcaggtatggaggaggaccagctgttaaccatctgtatgtttgtcatacc
tgccaaatagagtctgaaagacttgaaaaaagaaggaaaaatgaattggagatgtttatt
cggctttatagggcattccaagaagaagaatcttcatcaacattttactgcatcagtatg
cagtggttcagagaatgggaaggatttgtaaaaggcaaagacagtgatccccctggtcct
attgataatgctaaaattgcaataacaaaatgtggaaatgctgtgctaaaacaaggtgca
gattctggacagatatctgaagaaacatggaattttctgcagtcaatctatggtggaggc
ccagagattatacacagaccacctgctcctacagtagaacctgatatcttgcaaacagaa
gagaagattgaattagaaactcattgtctgtag

DBGET integrated database retrieval system