KEGG   Meleagris gallopavo (turkey): 100539060Help
Entry
100539060         CDS       T01523                                 

Gene name
ACACB
Definition
acetyl-CoA carboxylase beta
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100539060 (ACACB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100539060 (ACACB)
   00640 Propanoate metabolism
    100539060 (ACACB)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100539060 (ACACB)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100539060 (ACACB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100539060 (ACACB)
Enzymes [BR:mgp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100539060 (ACACB)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100539060 (ACACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
17
AA seq 2381 aa AA seqDB search
MLLASVLLMIFALLVLTKMSTLNARNEDEIAEQSPAPPPPPELAASLNPPVPSPPLQPAM
GEQEQIVVYNPTALRRPTLAKFVLGSFEDNSSDDEVVAAAFRVGSRRSSLASAGGTGAEP
PATAAPQEPTVGIRPSMSGLHLAKRSREHRKMDLQRDFTVASPAEFIARFGGTRVIEKVL
IANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIRMADHYVPVPGGA
NNNNYANVELIVDISKRIPVQAVWAGWGHASENPKLPELLQKNGIAFLGPPSDAMWALGD
KVASTIVAQTVQIPTLPWSGSGLVAQWSEEDQKNQQMISIPLETYGQGCVKDVEEGLEVA
KRIGYPLMIKAAEGGGGKGIRKVEAAEEFGTCFRQVQAEAPGSPIFLMKLAQHARHLEVQ
VLADEYGNAISLFGRDCSIQRRHQKIIEEAPVTIAAPAVIEVMEKCAVRLAQMVGYVSTG
TVEYLYSEDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQLQIAMGIPLHRIKDIRVLYG
ESPWGDTPICFNNPANPPVPRGHVIAARITSENPEEGFKPSSGTVQELNFRSSKNVWGYF
SVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETE
SFQSNEIDTGWLDHLIAEKVQAEKPDTMLGVVCGALNVADAAFRTCMTDFLHSLERGQVL
PAASLLNIIDVELIYEGMKYVLQVARQSLTTYVIIMNHTHIEIDVHRLTDGGLLLSYDGN
SYTTYMKEEIDRYRITIGNKTCDFEKEKDPTVLRSPSAGKLLQYTVDDGGHVAEGSVFAE
IEVMKIIMTLTVEEAGRVHYVKRPGALLEAGCVIAQLQLDDPTKVKSAQPFMGGLPAQQT
LPITGEKQHQVLRNVLDNLTNVMNGYCLPEPYFSTKVKEWVAQLMKTLRDPSLPLLELQE
IMTSISGRIPLSVEKAIRKVMAQYASNITSVLCRFPSQQIASVLDTHAATLQRKAEREVF
FMNTQSVVQLVQRYRSGIRGYMKAVVLDLLRRYLQVETQFQQAHYDKCVISLREQYKPDM
TPVLESIFSHAQVAKKNLLVTMLIDQLCGREPTLTDELAAILNELTQLSKTEHSKVALRA
RQVLIASHLPSYELRHNQVESIFLSAIDMYGHEFCPENLKKLILSETTIFDVLPFFFYHD
NQVVRMAALEVYVRRGYIAYELNSLQHRQLSDGTCLVEFQFMLPFSHPNSHLSAPRRMSV
PISISNPDLARHSTELFMDSGFSPLSQRMGAMVAFNKFEDFTRNFDEVISCFADPPLESS
LFSEARATIYGEEDAKNIHEEPIHILNIALRRADHAEDEKLVPIFRAFAQSKKNILVDCG
LRRITFLIAQQREFPKFFTFRARDEFAEDRIYRHLEPALAFQLELSRMRNFDLTAIPCAN
HKMHLYLGAAKVQAGAEATDYRFFIRAIVRHSDLITKEASFEYLQNEGERLLLEAMDELE
VAFNNTSVRTDCNHIFLNFVPTVVMDPSKIEESVRAMVMRYGSRLWKLRVLQAEVKINIR
LTPTATAIPIRLSLTNESGYYLDISLYKEVRDPSTGNIMFQSYGDKQGAQHGMLINTPYV
TKDLLQAKRFQAQSLGTTYVYDFPEMIRQALFKLWGSSDLHPKDVLTYTELVLDSQGQLV
QMNRLPGGNEVGMVAFKMKLKTPEYPKGRDIVLICNDITHMIGSFGPEEDMVFLRASELA
RAEGIPRVYIAANSGARIGFADEIKHMFQVAWVDPEDPYKGFKYLYLTPQDYTRISAMNS
VHCEHVEEGGESRYVLLDIIGKDNGFGVENLRAAGTIAGESSRAYDEIVTISMVTCRAIG
IGAYLVRLGQRVIQVENSHIILTGVTALNKVLGREVYTSNNQLGGVQVMHNNGISHITVP
DDFEGVYTILQWLSYMPKDNRSPVPVIAISDPIEREIDFVPSKVPYDPRWMLAGRPHPTL
KGTWQSGFFDQGSFLEIMKPWAQTVVVGRARLGGLPVGVIAVETRTVEVTIPADPANPDS
EAKIVQQAGQVWFPDSAFKTAQAIRDFNREHLPLMIFANWRGFSSGMKDMYDQMLKFGAF
IVDSLRDFKQPVLVYIPPHAELRGGSWVVMDPTINPLYVELYADKESRGGILEPGGTVEI
KFRKKDLVKTMRRIDKVYAKLVEQLGTPELSEGQRKELEKQLKAREELLLPMYYQVAMHF
ADLHDTPGRMQEKGVITDILEWKNARSFLYWRLRRLLLEEVVKLEILKANSKLSHIHIQS
MLRRWFMETEGAEKGYLWDNNQVVVEWLEKHMQEDDGSKSAIRENIKYLKRDYVLKHIRS
LVQANPEVAMDCIIQMAQHITRAQKAQVAHLLSTLDSENPS
NT seq 7146 nt NT seq  +upstreamnt  +downstreamnt
atgttgctggcgtccgtgctcctgatgatctttgcactgctcgtcttgaccaagatgtcc
accttgaacgccaggaatgaagatgagatcgctgagcagagcccagccccgcctcccccc
ccagagctggcggcctccctaaaccccccggtccccagccccccattgcagcctgccatg
ggggagcaggagcagattgtggtgtacaaccccactgcgctccgcaggcccaccctggcc
aagtttgtgctgggctcctttgaggacaactcctctgatgacgaggtggtagctgcagct
ttcagggtgggcagccgccgcagcagcctggccagtgcaggggggacgggtgctgagccc
cccgccactgctgctccacaggaacccactgttggcataaggcctagcatgtctgggctg
cacctggcgaagcgcagccgcgagcaccgcaagatggacctgcagagggacttcactgtg
gcctcacctgctgagttcatcgcccgcttcggggggacccgcgtcattgagaaggtcctg
attgccaacaatggcatcgctgctgtcaaatgcatgcgctccatccgccgctgggcctac
gagatgttccgaaatgagcgtgccattcggtttgtggtcatggtcacccctgaagatctc
aaggctaacgcagagtacatcagaatggcagatcactacgtgcctgtccctggaggggcc
aacaacaacaactatgccaacgtggagctgattgtggacatttccaaacggatcccagtc
caggcggtatgggctggctggggacatgcctcggaaaaccccaagctgccagagctgctg
cagaaaaatgggatagctttcctaggtccccccagcgatgccatgtgggccctgggggat
aaagttgcctctaccatcgtggctcagacagtccagataccaacgctgccatggagtggg
agtggtctggtggcccagtggtctgaggaggaccagaagaatcagcagatgatcagcatt
cccctcgagacgtacggacagggctgcgtgaaggatgtggaagaaggcctggaggtggcc
aagaggatcggatacccactgatgatcaaggcagcagaaggaggtgggggcaaaggcatc
cggaaagtggaggcagcagaggagtttgggacctgcttccgacaggtgcaggcagaggca
cctgggtcccccattttcctgatgaagctggcccagcacgcgcggcacctggaggtgcag
gtgctggctgatgagtatggcaatgccatctccctctttggccgtgactgctccatccag
cgccggcaccagaagatcatcgaggaggcacccgtcaccattgcagctcctgctgtcatt
gaggtgatggagaagtgcgccgtccgcctggcacagatggtgggctatgtgagcacaggc
actgtcgagtatctctacagtgaagatgggagcttccacttccttgagctgaacccacgc
ctgcaggtcgagcacccttgcacagagatgatcgcagatgtgaacctccctgctgcccag
ctccagattgcaatgggcatccccttgcacaggataaaagacatccgagtgctgtatggg
gagagcccatggggcgatactcccatctgcttcaacaaccctgccaaccccccggtgccc
aggggccacgtcattgccgcacgcatcaccagtgagaatcctgaggagggtttcaagccc
agctcagggacggtacaggaactgaatttccgcagcagcaagaatgtctgggggtatttc
agcgtggcagctgctgggggactgcacgaatttgctgattcccagtttgggcactgcttc
tcgtggggagagaacagagaggaggccatctcgaatatggtggtggccctgaaagaactt
tccatccgtggggatttccgcaccacagtggaatatctgataaaacttttggagacggag
agcttccagagcaatgagatcgacaccggctggctggaccatctgatcgctgagaaagtg
caggcagagaagccggacacgatgctgggtgttgtctgtggtgctctgaacgtcgcagat
gctgccttcaggacgtgcatgactgacttcctacactcgctggagaggggccaggtgctg
cctgcagcctccttgctgaacattatcgacgtggagctcatctacgagggcatgaaatat
gttctccaggttgcccggcagtccttgacaacgtatgtcatcatcatgaaccacactcac
atcgagatagatgtgcaccggctgaccgacggcgggctgctgctctcctacgatggcaac
agctacaccacctacatgaaggaggagatcgacaggtaccggatcacgattggcaacaaa
acgtgtgactttgaaaaggagaaggacccaacagtgctgcgctccccatctgcaggaaag
ctgctgcagtacacagtggatgatggcggccacgttgccgaggggagcgtttttgcagag
attgaggtgatgaagatcatcatgacgctgacggtggaggaggcaggcagggtgcactat
gtcaagcggccgggtgcgctgctggaggcaggctgcgtcattgcacagctccagctggat
gatcccaccaaagtgaagtctgcacagccattcatgggggggctcccagcacaacagacc
ctccctattactggtgaaaaacagcaccaggttctgcgcaatgtgcttgacaacctcacc
aatgtcatgaatgggtactgcctgcccgagccctacttcagcaccaaggtgaaggaatgg
gtggcacagctgatgaagactctgcgggacccctccttgcctctcctggagctgcaggaa
atcatgacgagcatttcaggaagaatccctctctcggtggagaaggcgatccgcaaagtg
atggctcagtatgccagcaacatcacctctgtactctgccgcttccccagccagcagatc
gccagtgtgctggatactcacgcagccacgctgcagaggaaggctgagcgggaggtcttc
ttcatgaacacgcagagtgtggtgcagctggtgcagaggtaccgtagtggcatccgtggc
tacatgaaggcggtggtgctggacctgctgagacgctacctgcaagtggagacacagttc
cagcaagctcactacgacaagtgtgtcatcagcctgcgggagcagtacaaacccgacatg
acccccgtgctggagagcatcttctcccatgcccaggtggcaaagaagaacctgctggtg
accatgttaattgaccagctgtgtggccgggaacccacgctgacagatgagctggcagcc
atcctgaacgagctgacacagctcagtaagacagaacactctaaagtggcactgagagcc
cggcaggttctcattgcctctcacctgccctcctatgagctgcggcacaaccaggtggag
tccatattcctctccgctatcgacatgtatggacatgagttctgccctgaaaacctgaag
aaactgatcctctcagaaaccaccatctttgacgtgcttcctttcttcttctaccatgac
aaccaggttgtgcgcatggcagcgctggaggtgtatgtgcgacgtgggtacattgcctat
gagctgaacagcctgcagcacaggcagctctcagatggcacctgcctggtagagttccag
ttcatgctgcccttctctcacccaaatagccacctctctgccccacgcaggatgtctgtc
cccatcagcatctccaaccccgacctggctcggcacagcaccgagctcttcatggacagt
ggcttttcccccctgagccaacggatgggagccatggtggccttcaacaaatttgaggac
ttcacaaggaactttgatgaagtgatctcttgctttgctgacccacctttggagagttcc
ctcttcagtgaggcacgagccaccatctatggggaggaggatgccaagaacatccatgag
gaaccaatccatatcctcaacattgcgctccgccgggcggaccatgccgaggatgagaag
ctggtgcctatcttcagagcttttgcccagtccaagaaaaacatccttgttgactgtggt
ctccgaagaatcacgtttctcattgcccagcagagagaattcccaaagtttttcacattc
agagccagggatgagtttgcagaggaccgcatctaccggcacctggagccggcgctggcc
ttccagctggagctgagccgcatgcgcaacttcgacctgacagccatcccctgtgccaac
cacaagatgcacctctacctgggggcagccaaagtgcaggcgggcgccgaggccaccgac
tatcgcttcttcatccgtgccattgtgcggcactcagacctcatcaccaaggaggcctcc
tttgagtacctgcagaacgagggtgagcgcttgctcctagaggcgatggatgagctggag
gtggccttcaacaacaccagcgttcgcaccgactgcaaccacatctttctcaactttgtc
cccactgttgtcatggacccttccaagatcgaggagtcggtacgggccatggtgatgcgc
tatggcagccgcctctggaagcttcgggtcctgcaggcagaggtgaagatcaacatccgc
ctgacacccaccgccacggccatccccatccgcctctccctgaccaacgagtctggctac
tacctggacatcagcctctataaggaagtgagggaccccagcactggcaatatcatgttc
cagtcctatggggacaagcaaggggcacagcatggcatgctcatcaataccccctatgtc
accaaggacctgctccaggccaagcgcttccaggcacagtccttgggcaccacctatgtg
tatgacttcccggagatgatcaggcaggctctcttcaagctgtgggggtcctcagatctg
caccccaaagatgtcctgacatacacagagctggtgctggactcgcagggacagctggtg
cagatgaacaggctccctggagggaatgaggtggggatggttgcattcaaaatgaagctg
aagacccctgagtacccaaagggtcgggacatcgtgctcatctgcaatgacatcacacac
atgattggctcctttgggccggaggaggacatggtgttcctgagagcctcggagctggca
cgggctgaaggcatccctcgtgtctacattgctgccaacagcggtgcgcgtattggcttt
gctgacgagataaagcacatgttccaggtggcctgggtggaccctgaggacccctacaag
gggttcaagtacctgtacctgactccccaggactacacgagaatcagtgccatgaactct
gtgcactgtgagcatgtggaggaagggggtgagtccaggtacgtccttttggacatcatt
gggaaggataatggttttggagtggaaaacctgcgagctgctggcaccattgctggagag
tccagtcgtgcttatgatgaaatagtgaccatcagcatggtgacttgtcgtgccattggg
atcggtgcatacctagtgaggctgggccagcgtgtcatccaggtggagaactcccacatc
atcctgactggggtcacagctctcaataaggtgttggggcgtgaagtttacacatccaat
aaccagctgggaggtgtgcaggtcatgcacaacaatggtatttcccacatcactgtccca
gatgactttgaaggagtctacaccatcctgcagtggctctcctacatgcccaaggataat
cggagcccagtgcctgtcattgccataagtgaccccatcgaaagagaaatcgattttgtc
ccttccaaagtcccttatgaccccaggtggatgctggcagggagaccccatccaactctc
aaggggacgtggcagagtggtttctttgaccagggaagcttcctggagatcatgaagccg
tgggctcagacggttgtggttggcagagcgaggctgggaggtctccctgtgggcgtcatt
gctgtcgagacacgcactgtggaggtgacaatacctgcagaccctgccaaccctgactcg
gaggcaaagatagtccagcaggcaggacaggtctggtttccagattctgctttcaaaaca
gcgcaggccattcgggacttcaaccgtgagcacctcccattgatgatctttgccaactgg
aggggcttttccagtggcatgaaagacatgtatgaccaaatgctgaagtttggtgccttc
atcgtcgatagcctgcgggattttaagcagcctgtcctcgtgtacatcccaccgcacgcc
gagctgcggggtggctcctgggtggtcatggaccccaccatcaaccccctgtatgtggag
ctctacgcagacaaggagagcaggggtggcattttggagcctggaggaacagtggagatc
aagttcaggaagaaagatttggtgaagaccatgagaaggatcgataaagtttatgccaag
cttgtggagcagctggggacacctgaactgtctgaggggcagcgcaaggagctggagaag
cagctcaaggcccgggaggagctcctgctgcccatgtattaccaggtggccatgcacttt
gctgacctgcacgacacccctggccgcatgcaggagaaaggcgtcatcacagacatcctg
gagtggaagaatgcccgctcattcctctactggcggctgcgacggctgctgctggaagag
gtggtgaagttggagatcctgaaagccaacagcaagctgagccacatccacatccagtcc
atgctgcggcgctggtttatggagacagaaggagctgagaaagggtacctctgggacaac
aaccaggtggtggtggagtggctggagaaacacatgcaggaggatgacggcagcaagtca
gccatccgggagaacatcaagtacctgaaacgggactacgtgctcaagcacatccggagc
ctggtccaagccaaccccgaggtggccatggactgcatcatccagatggctcagcacatc
acccgcgcacagaaggctcaggtcgcccatctcctgtcgacattggacagtgagaacccg
tcctga

DBGET integrated database retrieval system