KEGG   Meleagris gallopavo (turkey): 100539203Help
Entry
100539203         CDS       T01523                                 

Gene name
HAT1
Definition
histone acetyltransferase 1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100539203 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 360 aa AA seqDB search
MAGLTPMEKKLAEYKCNTNEAIQLKLVRFPEDLEDDNTTFNPEYSHQVFGDDEVAFGYKG
LKILLYYIAGNLSTLFRIEYTSKVNEKFDCVEADDVESKIREIIPPGFCTNTDDFVSLLE
KEVNFKPFGMLLHTYSVHNEEAGEDIAYQIYKADMTCPGFREYHERLQTFLMWFIETASF
IDVDDERWNYFIVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILPPFQGEG
HGAQLLETVHRYYMSSPTVLDITAEDPSENYIKLRDFVLVKLCQDLLCFSPGKLMQGFSQ
EMVMEAQQKLKINKQHTRRVYEILRLRATDMGDAEQSRSYRLDVKRRLIGPYKVYDLCII
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacttactccaatggagaagaagctggctgaatacaaatgtaacacaaatgaa
gcaattcagctaaaactagttcgctttcctgaggatttagaggatgacaacacaacattt
aatccagagtatagccatcaagtgtttggtgatgatgaagttgcctttggctacaaggga
ctgaagattctcttatactatattgctggtaacctgtcaactctcttccgcattgaatat
acatctaaagttaatgagaagtttgactgtgtggaggcagatgatgttgaaagtaaaatt
agagaaattattcctcctggcttttgtacaaacacagatgactttgtctctctgttggaa
aaggaggtcaactttaagccctttggaatgctgctacacacatattctgttcataatgag
gaagctggtgaagacattgcatatcagatatataaggctgacatgacgtgtccaggcttt
cgagaatatcatgaaaggcttcagacattcttgatgtggtttattgaaactgctagcttt
attgatgtagatgatgaaagatggaactactttatagtatttgagaagtataataaggat
ggagctacgctctttgcgaccgtaggctacatgacagtctataattactatgtgtaccca
gacaaaacccggccacgtgtaagccagatgctgatcttgccaccattccaaggagaaggc
catggtgctcagcttctcgaaacagttcatagatactatatgtcttctcctacagtactt
gatataacagctgaagatccatctgaaaactacataaagctaagagactttgttcttgta
aagctctgtcaagacttgctttgcttttccccaggaaagttaatgcaaggattcagccaa
gaaatggtaatggaagctcaacagaagctgaaaataaataagcaacacacaaggagagtt
tatgaaattctccgattgcgtgcaacagatatgggcgatgcagaacaatccagaagctac
cggttggatgttaaaagaaggctgattggcccctataaggtatatgacttgtgtatcatt
taa

DBGET integrated database retrieval system