KEGG   Meleagris gallopavo (turkey): 100539255Help
Entry
100539255         CDS       T01523                                 

Definition
insulin receptor substrate 1-like
Orthology
K16172  
insulin receptor substrate 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mgp04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:mgp04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:mgp04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:mgp04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 732 aa AA seqDB search
MASPTDNNEGFFSDVRKVGYLRKPKSMHKRFFVLRAASESGPARLEYYENEKKWRHKSGA
PKRSIPLESCFNINKRADSKNKHLVALYTKDEHFAIAADSELEQESWYQALLQLHNRAKG
HHHLHHHHHHHHSDVTFGGSSVGLGEAGEDSYGEVAPGPAFKEVWQVILKPKGLGQTKNL
IGIYRLCLTNKTISFVKLNSDAAAVVLQLLNIRRCGHSENFFFIEVGRSAVTGPGEFWMQ
VDDSVVAQNMHETILEAMRAMSEEFRPRSKSQSSSNCSNPISVPLRSRHHINNPPPSQVG
LSRRSRTESVTATSPAGGGGGGMGGKPNSFRVRASSDGEGTMSRPASVDGSPVSPSANRT
HSHRHRGNSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSA
SVSGSPSDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGDEELNYICMGGKAASS
CCSLAAPNGHFIPRTCHPQQQPRYPSTSCCPRAGSEDIADLDKAFRKRTHSAGTSPTISH
QKTPSQSSVASIEEYTEMLPSYPCGSSRLPSYRHSAFVPTHSYPEECLEMHHLDGSHHRT
NSAPHTDDGYMPMSPGVAPLPSGGAAPKGGDYMPMSPKSVSAPQQIINPGRGGRHPPATV
DSNGYMMMSPSGSYSPDSGSAGYGKIWTNGAGHHPKLSVESNEGKLPCGGGDYINMSPAS
GSTTSTPPDCYF
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggccagtcccacagataacaacgagggcttcttctcggatgtcagaaaggtgggttac
ttgcgcaaacccaagagcatgcataaacgctttttcgtgctaagggcagccagcgagtct
ggacccgcccggctggagtattatgaaaatgagaagaaatggagacacaagtcgggggcc
cccaagcgctccatcccattggaaagctgcttcaacatcaacaagcgggctgactccaag
aacaagcacctggtggccctctacaccaaggacgagcactttgccatcgcagctgacagt
gaactggaacaggagagctggtaccaagcgctgctgcagttgcacaacagggccaaaggc
caccaccacctccaccaccatcaccaccaccaccacagcgatgtcacctttgggggcagc
agcgtggggctgggggaagcaggtgaggacagctatggtgaggtagcccctggccctgct
tttaaggaagtttggcaagtaattctgaagcctaaggggctaggccagacaaagaacctg
attggcatctaccgcctgtgcctgactaacaagaccatcagcttcgtaaagctgaattcg
gatgcggctgctgtggtgctgcagctgctcaatatccgccgttgcggacattctgagaac
ttcttcttcattgaggtgggacgctcggcagtgaccgggcccggggagttctggatgcag
gtggatgactctgtggtggcgcagaacatgcatgaaaccatcctggaggccatgagagcc
atgagtgaggaattccgaccgcgcagcaagagccagtcgtcctctaactgttccaacccc
atctccgtgccccttcgtagcaggcatcacatcaacaaccctccgcccagccaagtgggg
ctcagtcgccggtccagaaccgagagcgttacagccacctccccagctggcggtggggga
ggaggtatgggtggcaaacccaactccttccgggtccgcgcatccagcgatggggaaggc
accatgtcaaggcctgcctcggtggatggtagcccagttagccccagtgccaaccggacc
cactcgcacagacaccgtggcaactccaggctccatcctccgctcaaccacagtcgttcc
atcccgatgccttcctcgcgctgctccccatcggccaccagcccagtcagcctgtcgtcc
agcagcaccagtggccacggctccacatcagactgcctgtttccacgaaggtccagtgct
tcggtttctggctcccctagcgatggtggatttatttcttctgatgaatatggttctagc
ccgtgtgacttccgcagctcttttcgcagcgtgaccccagattctctaggacacaccccg
ccagctcggggcgatgaagagctcaactacatctgcatgggggggaaggccgcttcgtcc
tgctgcagcctggcagctcccaatggccacttcatcccacgcacctgccacccacagcag
cagccccgctaccccagcacgtcatgctgtccccgagccggtagcgaggacattgctgat
ttggacaaggcgttcaggaaacggactcactctgcaggcacttcacccaccatctcccac
cagaagacaccctcccagtcttcggtggcttccattgaggagtatacagagatgttgcct
tcttacccctgcggcagcagccggctgccctcctaccggcactcggcctttgtgcccact
cactcctatcctgaggagtgtctagagatgcaccacctggatggcagccatcatcggacc
aactctgctccgcacacggatgacggctacatgcccatgtcccctggcgtagcccccttg
cccagcggtggggctgcccccaagggcggtgactatatgcccatgagtcccaagagcgtg
tcggccccgcagcagatcatcaaccccggcagagggggccgccaccctccggctacggtg
gactccaacggctacatgatgatgtcccccagcggcagctactccccggacagcggctct
gcgggctacggcaagatttggacgaacggtgccggccaccacccaaagctctcggtggag
agcaacgaagggaagctgccctgcggcggcggcgactacatcaacatgtccccggccagc
ggctccaccaccagcacgccgcccgactgctacttc

DBGET integrated database retrieval system