KEGG   Meleagris gallopavo (turkey): 100539255Help
Entry
100539255         CDS       T01523                                 

Gene name
IRS1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04068  FoxO signaling pathway
mgp04140  Autophagy - animal
mgp04150  mTOR signaling pathway
mgp04910  Insulin signaling pathway
mgp04920  Adipocytokine signaling pathway
Module
mgp_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100539255 (IRS1)
   04150 mTOR signaling pathway
    100539255 (IRS1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100539255 (IRS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100539255 (IRS1)
   04920 Adipocytokine signaling pathway
    100539255 (IRS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11
Motif
Other DBs
NCBI-GeneID: 100539255
NCBI-ProteinID: XP_003209117
Position
11
AA seq 776 aa AA seqDB search
MASPTDNNEGFFSDVRKVGYLRKPKSMHKRFFVLRAASESGPARLEYYENEKKWRHKSGA
PKRSIPLESCFNINKRADSKNKHLVALYTKDEHFAIAADSELEQESWYQALLQLHNRAKG
HHHLHHHHHHHHSDVTFGGSSVGLGEAGEDSYGEVAPGPAFKEVWQVILKPKGLGQTKNL
IGIYRLCLTNKTISFVKLNSDAAAVVLQLLNIRRCGHSENFFFIEVGRSAVTGPGEFWMQ
VDDSVVAQNMHETILEAMRAMSEEFRPRSKSQSSSNCSNPISVPLRSRHHINNPPPSQVG
LSRRSRTESVTATSPAGGGGGGMGGKPNSFRVRASSDGEGTMSRPASVDGSPVSPSANRT
HSHRHRGNSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSA
SVSGSPSDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGDEELNYICMGGKAASS
CCSLAAPNGHFIPRTCHPQQQPRYPSTSCCPRAGSEDIADLDKAFRKRTHSAGTSPTISH
QKTPSQSSVASIEEYTEMLPSYPCGSSRLPSYRHSAFVPTHSYPEECLEMHHLDGSHHRT
NSAPHTDDGYMPMSPGVAPLPSGGAAPKGGDYMPMSPKSVSAPQQIINPGRGGRHPPATV
DSNGYMMMSPSGSYSPDSGSAGYGKIWTNGAGHHPKLSVESNEGKLPCGGGDYINMSPAS
GSTTSTPPDCYFGAAGQPVVEEAAAAVLHKPIYSYFSLPRSFKHVHRRAGGQAGEE
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggccagtcccacagataacaacgagggcttcttctcggatgtcagaaaggtgggttac
ttgcgcaaacccaagagcatgcataaacgctttttcgtgctaagggcagccagcgagtct
ggacccgcccggctggagtattatgaaaatgagaagaaatggagacacaagtcgggggcc
cccaagcgctccatcccattggaaagctgcttcaacatcaacaagcgggctgactccaag
aacaagcacctggtggccctctacaccaaggacgagcactttgccatcgcagctgacagt
gaactggaacaggagagctggtaccaagcgctgctgcagttgcacaacagggccaaaggc
caccaccacctccaccaccatcaccaccaccaccacagcgatgtcacctttgggggcagc
agcgtggggctgggggaagcaggtgaggacagctatggtgaggtagcccctggccctgct
tttaaggaagtttggcaagtaattctgaagcctaaggggctaggccagacaaagaacctg
attggcatctaccgcctgtgcctgactaacaagaccatcagcttcgtaaagctgaattcg
gatgcggctgctgtggtgctgcagctgctcaatatccgccgttgcggacattctgagaac
ttcttcttcattgaggtgggacgctcggcagtgaccgggcccggggagttctggatgcag
gtggatgactctgtggtggcgcagaacatgcatgaaaccatcctggaggccatgagagcc
atgagtgaggaattccgaccgcgcagcaagagccagtcgtcctctaactgttccaacccc
atctccgtgccccttcgtagcaggcatcacatcaacaaccctccgcccagccaagtgggg
ctcagtcgccggtccagaaccgagagcgttacagccacctccccagctggcggtggggga
ggaggtatgggtggcaaacccaactccttccgggtccgcgcatccagcgatggggaaggc
accatgtcaaggcctgcctcggtggatggtagcccagttagccccagtgccaaccggacc
cactcgcacagacaccgtggcaactccaggctccatcctccgctcaaccacagtcgttcc
atcccgatgccttcctcgcgctgctccccatcggccaccagcccagtcagcctgtcgtcc
agcagcaccagtggccacggctccacatcagactgcctgtttccacgaaggtccagtgct
tcggtttctggctcccctagcgatggtggatttatttcttctgatgaatatggttctagc
ccgtgtgacttccgcagctcttttcgcagcgtgaccccagattctctaggacacaccccg
ccagctcggggcgatgaagagctcaactacatctgcatgggggggaaggccgcttcgtcc
tgctgcagcctggcagctcccaatggccacttcatcccacgcacctgccacccacagcag
cagccccgctaccccagcacgtcatgctgtccccgagccggtagcgaggacattgctgat
ttggacaaggcgttcaggaaacggactcactctgcaggcacttcacccaccatctcccac
cagaagacaccctcccagtcttcggtggcttccattgaggagtatacagagatgttgcct
tcttacccctgcggcagcagccggctgccctcctaccggcactcggcctttgtgcccact
cactcctatcctgaggagtgtctagagatgcaccacctggatggcagccatcatcggacc
aactctgctccgcacacggatgacggctacatgcccatgtcccctggcgtagcccccttg
cccagcggtggggctgcccccaagggcggtgactatatgcccatgagtcccaagagcgtg
tcggccccgcagcagatcatcaaccccggcagagggggccgccaccctccggctacggtg
gactccaacggctacatgatgatgtcccccagcggcagctactccccggacagcggctct
gcgggctacggcaagatttggacgaacggtgccggccaccacccaaagctctcggtggag
agcaacgaagggaagctgccctgcggcggcggcgactacatcaacatgtccccggccagc
ggctccaccaccagcacgccgcccgactgctacttcggggcggcggggcagccggtcgtc
gaggaggcggccgccgcggtcctgcacaaacccatctactcctacttctcgttgccgcgc
tccttcaagcacgtgcaccggcgggccggcgggcaggcgggcgaggag

DBGET integrated database retrieval system