KEGG   Meleagris gallopavo (turkey): 100539255Help
Entry
100539255         CDS       T01523                                 

Definition
insulin receptor substrate 1-like
Orthology
K16172  
insulin receptor substrate 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100539255
   04150 mTOR signaling pathway
    100539255
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100539255
   04920 Adipocytokine signaling pathway
    100539255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 732 aa AA seqDB search
MASPTDNNEGFFSDVRKVGYLRKPKSMHKRFFVLRAASESGPARLEYYENEKKWRHKSGA
PKRSIPLESCFNINKRADSKNKHLVALYTKDEHFAIAADSELEQESWYQALLQLHNRAKG
HHHLHHHHHHHHSDVTFGGSSVGLGEAGEDSYGEVAPGPAFKEVWQVILKPKGLGQTKNL
IGIYRLCLTNKTISFVKLNSDAAAVVLQLLNIRRCGHSENFFFIEVGRSAVTGPGEFWMQ
VDDSVVAQNMHETILEAMRAMSEEFRPRSKSQSSSNCSNPISVPLRSRHHINNPPPSQVG
LSRRSRTESVTATSPAGGGGGGMGGKPNSFRVRASSDGEGTMSRPASVDGSPVSPSANRT
HSHRHRGNSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSA
SVSGSPSDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGDEELNYICMGGKAASS
CCSLAAPNGHFIPRTCHPQQQPRYPSTSCCPRAGSEDIADLDKAFRKRTHSAGTSPTISH
QKTPSQSSVASIEEYTEMLPSYPCGSSRLPSYRHSAFVPTHSYPEECLEMHHLDGSHHRT
NSAPHTDDGYMPMSPGVAPLPSGGAAPKGGDYMPMSPKSVSAPQQIINPGRGGRHPPATV
DSNGYMMMSPSGSYSPDSGSAGYGKIWTNGAGHHPKLSVESNEGKLPCGGGDYINMSPAS
GSTTSTPPDCYF
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggccagtcccacagataacaacgagggcttcttctcggatgtcagaaaggtgggttac
ttgcgcaaacccaagagcatgcataaacgctttttcgtgctaagggcagccagcgagtct
ggacccgcccggctggagtattatgaaaatgagaagaaatggagacacaagtcgggggcc
cccaagcgctccatcccattggaaagctgcttcaacatcaacaagcgggctgactccaag
aacaagcacctggtggccctctacaccaaggacgagcactttgccatcgcagctgacagt
gaactggaacaggagagctggtaccaagcgctgctgcagttgcacaacagggccaaaggc
caccaccacctccaccaccatcaccaccaccaccacagcgatgtcacctttgggggcagc
agcgtggggctgggggaagcaggtgaggacagctatggtgaggtagcccctggccctgct
tttaaggaagtttggcaagtaattctgaagcctaaggggctaggccagacaaagaacctg
attggcatctaccgcctgtgcctgactaacaagaccatcagcttcgtaaagctgaattcg
gatgcggctgctgtggtgctgcagctgctcaatatccgccgttgcggacattctgagaac
ttcttcttcattgaggtgggacgctcggcagtgaccgggcccggggagttctggatgcag
gtggatgactctgtggtggcgcagaacatgcatgaaaccatcctggaggccatgagagcc
atgagtgaggaattccgaccgcgcagcaagagccagtcgtcctctaactgttccaacccc
atctccgtgccccttcgtagcaggcatcacatcaacaaccctccgcccagccaagtgggg
ctcagtcgccggtccagaaccgagagcgttacagccacctccccagctggcggtggggga
ggaggtatgggtggcaaacccaactccttccgggtccgcgcatccagcgatggggaaggc
accatgtcaaggcctgcctcggtggatggtagcccagttagccccagtgccaaccggacc
cactcgcacagacaccgtggcaactccaggctccatcctccgctcaaccacagtcgttcc
atcccgatgccttcctcgcgctgctccccatcggccaccagcccagtcagcctgtcgtcc
agcagcaccagtggccacggctccacatcagactgcctgtttccacgaaggtccagtgct
tcggtttctggctcccctagcgatggtggatttatttcttctgatgaatatggttctagc
ccgtgtgacttccgcagctcttttcgcagcgtgaccccagattctctaggacacaccccg
ccagctcggggcgatgaagagctcaactacatctgcatgggggggaaggccgcttcgtcc
tgctgcagcctggcagctcccaatggccacttcatcccacgcacctgccacccacagcag
cagccccgctaccccagcacgtcatgctgtccccgagccggtagcgaggacattgctgat
ttggacaaggcgttcaggaaacggactcactctgcaggcacttcacccaccatctcccac
cagaagacaccctcccagtcttcggtggcttccattgaggagtatacagagatgttgcct
tcttacccctgcggcagcagccggctgccctcctaccggcactcggcctttgtgcccact
cactcctatcctgaggagtgtctagagatgcaccacctggatggcagccatcatcggacc
aactctgctccgcacacggatgacggctacatgcccatgtcccctggcgtagcccccttg
cccagcggtggggctgcccccaagggcggtgactatatgcccatgagtcccaagagcgtg
tcggccccgcagcagatcatcaaccccggcagagggggccgccaccctccggctacggtg
gactccaacggctacatgatgatgtcccccagcggcagctactccccggacagcggctct
gcgggctacggcaagatttggacgaacggtgccggccaccacccaaagctctcggtggag
agcaacgaagggaagctgccctgcggcggcggcgactacatcaacatgtccccggccagc
ggctccaccaccagcacgccgcccgactgctacttc

DBGET integrated database retrieval system