KEGG   Meleagris gallopavo (turkey): 100539312Help
Entry
100539312         CDS       T01523                                 

Definition
malonyl-CoA decarboxylase, mitochondrial-like
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100539312
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100539312
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100539312
Enzymes [BR:mgp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     100539312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 314 aa AA seqDB search
GVLKNMLSEWFSTGFLNLERVTWQSPCEVLQKISDSEAVHPVRNWVDMKRRVGSYRRCYF
FSHCAIPGEPLIVLHVALTSDISSSIQAIVKEVEPLETEVADKITTAIFYSISLTQQGLQ
GVELGTYLIKRVVKELQKELPQIKTFSTLSPIPGFTKWLVGLLSSQTKELEKNELFTESE
RQELSQITGDCTTETLKKLFNNNEWVRSEKLVKALHLPLMRLCAWYLYGEKHRGYALNPV
ANFHLQNGSVLWRINWMADTSPRGIAAACGMMVNYRYFLEDTASNSAAYLGTKAIKASEQ
VLSLVSQFQQNSKL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ggtgttctaaagaacatgctctcagagtggttttcaacaggattcctaaacttggagcgt
gtcacgtggcaatcaccttgtgaagtactccagaaaatcagtgattctgaagccgtgcat
cctgttagaaactgggttgatatgaagcgtcgagtggggtcatatagaagatgctacttt
ttttcccactgtgcaatcccaggagaaccgttgatagtcttgcatgttgcattaaccagt
gatatctccagcagcatccaggccatagtgaaagaagtggaacctttagaaacagaagtt
gcagacaaaattacaacagcaattttctactctatcagtttgactcagcaaggactgcaa
ggggtggaacttgggacttaccttatcaaacgtgtggtaaaggagctgcagaaagaactt
cctcagataaaaactttttctactctgtcgcctatccctgggttcacaaaatggctcgtt
ggtctcctctcctcacagacaaaagaactggaaaagaatgaactttttacagaatcagaa
cgccaagagctatctcagatcacaggagactgtactactgaaacactaaagaagctcttc
aacaacaacgaatgggtgcgatcagaaaagttagtcaaggctctccatttgccgctgatg
agactttgtgcctggtatttgtacggggagaaacaccgcggctacgcactgaacccagta
gcaaactttcaccttcagaatggctccgtgttgtggcggataaactggatggcagacacg
agccctcggggcatcgctgctgcgtgtggcatgatggtgaactaccggtacttcttagag
gatacagccagtaacagtgcagcctatctggggacaaaagccattaaagcctcagagcag
gttctttccttggtgtcgcagttccagcagaatagcaagctctaa

DBGET integrated database retrieval system