KEGG   Meleagris gallopavo (turkey): 100539320Help
Entry
100539320         CDS       T01523                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Apelin signaling pathway
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100539320 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100539320 (SPHK1)
   04371 Apelin signaling pathway
    100539320 (SPHK1)
   04020 Calcium signaling pathway
    100539320 (SPHK1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100539320 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
20
AA seq 506 aa AA seqDB search
MAAGRRVPPQDDGGAVLLRGRFSPGPSPGLVSCSVALTERELQVLRPGGPDAALRLADCV
GSAAFPSGPGAACFSLVGYPFRKARWGSPARQRLQRTFRVSQHPDAEENLRIAQAWSQRI
RELSLPAAPTRDGASYGVLPRPCRALVLLNPQSGAGRALEDFQAVVQPMLADADITPTVF
VTERPHHAQEKVQDEDLSQWDVLVVMSGDGLLHEVLNGLMERPDWEQALQTPLCILPGGS
GNALAASINYYAGNDHVAKKKLLTNCTFILCKGLHAPMDLVSLSTASGKRFFSFLGFGWG
FIADVDIDSEKYRRLGNARFTLGTLQCLVRLRIYQGRLSYLPAAAEPGSPRDPKTRRAAP
TAGTKALTGDGEPPADTLLVPLGQPVPPHWVVVPEEEFVCVYAIYQSHLGTNLLMAPAAR
LHDGCIHLFYVRAGISRVALLKIFLAMGRGTHLELNCPHLHCVPVRAFRLEPRGSAGVMT
VDGEALACEPVQGQIHGRMCRVVTGS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggccgccggccgccgggttcccccgcaagacgacggcggtgcggtgctgttgcggggc
cgcttctccccgggaccgtctcccggtttggtttcgtgttccgtcgctctgaccgaacgg
gagctgcaggtgctgcgtcccggcggtcccgacgcggctctccgtttggccgattgcgtg
ggtagcgccgcgttcccgtccggccccggcgccgcctgcttctccctcgtgggttacccg
ttccgtaaggcccgatggggttcccccgcccggcagcgcctgcagaggactttccgcgtt
tcccaacaccccgacgccgaagagaatctccgcatcgcccaggcctggagccaacgcatc
cgagagctctcgctgcccgcagcgcccacgcgggacggtgccagctatggggtgctgccc
cggccctgcagagctctggtgctgctgaacccgcagagcggagctggccgcgcgcttgag
gatttccaggcagtggtgcagcccatgctggctgatgctgacatcacacccaccgtcttt
gtcactgagagaccccaccacgcccaggagaaggtgcaggatgaagacctgtcgcagtgg
gatgtgctggtggtgatgtctggggatggtctgctccacgaggtgctgaatgggctgatg
gagcggccggactgggagcaggccctgcagacaccgctgtgcatcctgcctgggggctct
gggaacgccttggctgcctccatcaactactatgcaggcaacgaccacgtggccaagaag
aaactgctgaccaactgcaccttcatcctgtgcaaggggctgcacgctccgatggacctg
gtctcattgagcacggcctcgggcaaacgcttcttctccttcctgggcttcggatggggt
ttcatcgccgacgtggacattgacagtgagaagtaccggcggctgggcaacgcacgcttc
acgctgggcacgctgcagtgcttggtacgcctgcgcatctaccagggccgcctctcctac
ctgcctgcagccgccgagccgggcagccccagggaccccaagacccgccgggccgcacca
acagcggggacgaaggcactgactggggacggggagccgcccgctgacacgctgctggtg
ccgctggggcagccggtgccgccgcattgggtcgtggtgcccgaggaggaattcgtctgc
gtctacgccatctaccagtcccacctgggcaccaacctgctgatggctccggcggcgcgg
ctgcacgacggctgcatccacctcttctacgtgagggcgggcatcagccgcgtggcgctg
ctgaaaatcttcctggccatgggcagaggcacgcatctggagctgaactgcccccacctg
cactgcgtcccggtgcgcgccttccgcctggagccgcggggcagcgccggcgtcatgacg
gtggacggggaggcgttggcgtgcgagcccgtgcaggggcagatccacggccgcatgtgc
cgcgtggtcaccggctcctag

DBGET integrated database retrieval system