KEGG   Meleagris gallopavo (turkey): 100539358Help
Entry
100539358         CDS       T01523                                 

Gene name
KAT6B, MYST4
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100539358 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 1842 aa AA seqDB search
MVKLANPLYTEWILEAIQKVKKQKQRPSEERICHAVCASHGLDKKTVSEQLQLSVQDGSI
LKVTNKGLASYKDPDNPGRFSSVKPGTIPKSVKGSRGACNELRNVDWNKLLRRAIEGLQE
PGGSSLKNIEKYLRSQNDLASIFNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGGLE
SKGAPKYSSGFPASLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTSNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIRRRYAKPIGRPKNKLKQRMLSVTSDE
GSVNAFTGRGSPGRGQKTKVCTTPSSGHAASVKDSSSRLPVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSLVLA
TDTEIKLSIKQENTDVYLVGSKDTVTQEDLDVFKQARELSLEKIGCKNTADTSGRYPSVI
EFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYR
RNDLSVFEVDGNVSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVGYF
SKEKLCQQKYNVSCIMIMPQYQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRLSYL
AYWKSVILEYLNCHHEKQISIKGMSRATGMCPHDIATTLQQHSMIDKREDRFVIIRREKL
ISSHMEKLKANPRINEVDPESLRWTPLLVSNAAVSEEEREAEKEAERLMEQASCWEKEEQ
EIFSTRSNSRQSPAKVQSKNKYLRSPENVAVVGERGQSTELSKESSEEDGGDESQQSSPP
RLTKPQSLAMKRKRPFLLKKKRGRKRRRINSSVTTETISETTEVLNEPFDNSDEERPMPQ
LEPTCEMDGEDDDLKPVIRKAFEYQSGQQKQEKEEEQKKEEKDIHCYRSDDHCTDNTEDV
AVLEEGTKDNLEPLKSKQGWPKGVKRGPSKWRQNKERKPGFKLNLYTPPETPMEPDYQML
VEEQKEVAEDKPCPVPAVTEEEIKEPVEVLPPLDDEVKEREPEPLHPPGEPYEKQENDAV
KAGEEGRNVEDSEINSKDPEKDKPEEDFLQKEESMHLDDHDEEEEDDEEPSHNEDHDADD
EDDSHMGSAEVEKEDLPAEAFKEMLETQQSFLDVNVQSGNSNQEDLMDCGVDLAADECES
DQKEVATDSDPVPESDDDHNENNQDQKAGEELHSDFKGESNETMEIDSETVQAVQSLTQE
ASEQEDTFQDCAETQEACRSLQNYARTDQSPQMTTLDDCQQSDHSSPVSSVHSHPSQSVR
SVNSPNVAPLENNYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGS
IESTTENYENPSSYDSTMGSSICGNNSSQNSCSYSSLTSSNLTQSSCAVTQQMSNINGSC
SMMQQTNISSPPTCNVKSPQGCVVERPPSSNQQLSQCSMAANFTPPMQLTEIPEAGNANI
GLYERMGQSEFGPGHYSQPSATFSLAKLQQLTNTLMDHSLPYSHSAAVTSYANSASLSTP
XSNTGLVQLSQSPHAVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMTSSNIGISHTQR
LQTQMASKGHVSVRTKSTPLPPAAAAHQPQIYGRASQTVAMQGPTRTLTMQRGMNMSVNL
MPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQ
PYAQQPMQTAPHSNMMYSPPGHHGYMNTGMSKQSLNGSYMRR
NT seq 5529 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgccaacccactttatacggagtggattcttgaagctatacaaaaagtt
aaaaagcaaaagcaacggccatctgaagagagaatatgtcacgctgtttgtgcttcccat
ggattagataagaagactgtttcggaacagctgcaacttagtgttcaagatggttctatt
cttaaagttaccaacaaaggccttgcatcctacaaggacccagataatcctggacggttt
tcgtctgttaaacctggcactattccgaaatctgttaaaggatctagaggagcttgtaat
gagctccgtaatgtggattggaataaactgttgagaagagcaattgaagggcttcaagaa
ccaggtggctcctcgctgaaaaacatagagaagtatttgagaagtcaaaatgacctagca
agtattttcaacaaccctgcctttcagcagagattgcgtctgggggccaaacgtgctgtg
aacaatggcagattactgaaggatggacctcagtatagagtgaattatggcggtttggaa
agcaaaggagctcctaaatattccagtggtttcccagcttctcttccacctgtcagcctt
ctaccccatgaaaaagatcagccccgggctgatcccatccccatatgtagcttttgtttg
ggaacaaaagaatcaaatcgtgaaaagaaaccagaagagctgttgtcttgtgcagactgt
ggcagcagtggacatccatcatgtttgaaattctgtcccgagttaacatcaaatgtgaag
gctttaagatggcagtgtattgaatgcaagacgtgtagtgcatgtaggatccaaggcaaa
aatgcagataacatgcttttttgcgactcctgtgatagagggttccacatggagtgctgt
gacccaccactttcccgaatgccaaaagggatgtggatttgccaggtctgtagaccaaag
aagaaagggagaaagctccttcatgagaaagctgcccaaataaggcgacgatatgcaaaa
cctatcggacgaccgaaaaataaactaaagcaacgaatgttgtctgtaaccagtgatgaa
ggatccgtgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgtgaaggattcaagcagcagattgcct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacata
tctgcctctacacttaaagttaacaagaaaaccaaagggcttattgatggccttactaag
ttttttaccccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcttgtgttggct
acagatactgaaatcaaactaagcatcaaacaagaaaatacagatgtatatctggtggga
agcaaggacacggttacgcaggaggatttggacgtatttaaacaggctcgggaactttcc
ctggagaaaattgggtgtaaaaacactgctgatacaagtgggcgatacccttcggtgata
gagtttggaaaatatgagatccagacatggtactcttcaccttacccacaggaatatgca
agactaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagtaaaaacatt
ttgttaaggcattcaaagaagtgtggctggtttcatcctccagccaatgaaatctacaga
agaaatgacctgtcagtgtttgaggttgatggaaacgtgagcaaaatttattgtcagaat
ctttgtttgttagctaagctctttctggaccacaaaaccttgtattatgatgttgaacca
ttcctcttctatgttcttacaaaaaatgatgagaaaggatgccatttagttggatatttc
tctaaggaaaagctttgccagcagaagtacaatgtctcctgcataatgatcatgccccag
taccaaaggcaaggatttggaaggtttctcattgatttcagctatttactttctagaaga
gagggtcaagcaggatctcctgaaaagccattatctgatcttggtcgtctctcttatttg
gcttactggaaaagtgtaatattagaatatcttaactgccaccatgaaaagcaaatcagc
atcaaaggaatgagtcgagcaactggaatgtgtccacatgatattgccacaactctgcag
cagcatagcatgatagataaaagagaagatagatttgtaattattagaagggaaaagctg
atttcaagtcatatggagaaactgaaagcaaacccacgtattaatgaagtagatcctgaa
agcttgagatggactcctctattagtttctaatgctgcagtttctgaagaagagagagaa
gcagaaaaggaggctgagcgtctaatggagcaagctagctgctgggaaaaggaagagcaa
gaaatattctccacaagatctaacagtaggcaatcacctgcaaaagtacaatctaaaaat
aaatatttgcgatctccagaaaatgtggcagtggtgggggaacgagggcaatccacagag
ctatctaaggagagcagtgaggaggatggtggggatgagagtcagcagagttcgcctccc
cggctgacaaagccacagtcgctggccatgaaaagaaagagacctttcctactgaaaaag
aaaagaggtcgtaaacgcagaaggattaatagcagtgttacaacagagactatttctgaa
actacggaggtgttgaatgagccatttgataactcagatgaagaacgtcccatgccacag
ctggagcctacctgtgagatggatggggaagatgatgacttgaagcctgtgattagaaaa
gcttttgagtatcagtcagggcagcagaaacaggagaaggaggaagagcagaaaaaagag
gagaaagacattcattgctacaggagtgatgaccattgtacagataatacagaggatgta
gctgtattggaagaaggcactaaagacaatcttgaacctttaaagagtaagcagggttgg
cccaaaggagtcaagcgcggtccatctaaatggcggcaaaacaaagaaagaaaacctggc
tttaagcttaatttatacactccacctgagactcctatggagcctgactatcagatgctg
gtggaggagcaaaaggaagttgctgaagataagccctgtccagttcctgctgttacagag
gaagagattaaagagcctgttgaagtattaccaccgctggatgatgaggtaaaagagaga
gaacctgaacctctgcatccacctggtgaaccctatgaaaaacaagaaaatgatgcagtg
aaagctggggaagaaggaaggaatgtagaagacagtgaaatcaattcaaaagatccagaa
aaagacaaaccagaagaggattttctgcaaaaagaagagtccatgcacttggatgatcat
gatgaggaagaggaagatgatgaagaaccttctcacaatgaagatcatgatgcagatgat
gaagatgatagccacatgggttcagcagaagtggagaaagaagatttgcctgccgaagct
ttcaaagaaatgctggaaacacagcagtcttttttagacgtaaatgttcagagtggtaat
tcgaatcaggaggacttgatggactgtggtgtggaccttgcagctgatgagtgtgaaagt
gaccagaaagaagtagctacagattcagacccagtgccggaatctgatgatgatcataat
gaaaacaaccaggaccaaaaagctggtgaagaattacattccgatttcaagggagagagt
aatgagactatggagattgattctgagacagttcaagcagtacagtctctaactcaagaa
gcaagtgaacaggaagatacctttcaggattgtgcagagactcaggaggcctgtagaagt
ttgcaaaactatgcccgcacagaccaaagcccccaaatgaccacgttggatgattgtcag
cagtctgaccacagcagcccagtttcctctgtgcactctcatcctagccagtcagttcgt
tctgttaatagtccaaacgttgctccgttagagaacaactatgctcagatcagcccagat
caaagtgccatttctgtgccatctctacagaatatggagactagcccaatgatggatgtt
ccctcagtttctgatcattcacaacaagttgtggatagtggctttagtgatttaggaagc
attgaaagcacaacagaaaactatgaaaacccaagcagttatgactctacaatgggtagt
agtatctgcggaaacaactcttcacaaaatagttgctcgtacagtagccttacatctagc
aacctaacacagagtagctgtgcagtgacacagcagatgtctaatattaacggaagctgt
agtatgatgcagcaaacaaacatcagttctcctcccacttgtaacgtgaaatctccccaa
ggttgtgttgttgaaaggcctccaagcagcaaccagcagttatctcagtgcagcatggcc
gctaattttacaccacctatgcagttaactgaaatccctgaagctggcaatgccaacatt
ggcttatatgaaagaatgggtcagagcgaattcggaccaggacactactcgcagccatcg
gccaccttcagccttgccaaactgcagcagttaactaacacgcttatggatcattctttg
ccttacagccattcagctgctgtaacttcctatgcaaacagtgcctctctgtccaccccc
ntaagtaatacagggcttgttcagctttctcagtctccacatgctgttcctggaggacca
caagcacaggctaccatgactcctccccccaaccttactcctcctcccatgaatttgcca
cctccccttttgcagcgtaacatgacttcatcgaatattggaatatcccacacccaaaga
ctgcagactcagatggccagcaaaggtcatgtttctgtaagaaccaaatctacacctctg
ccacctgctgcagcggcccatcaaccccagatttacggccgtgcttcacaaactgtggcc
atgcaagggcccacacggaccttaacaatgcagcgtggtatgaacatgagtgtaaatttg
atgccagccccagcttataatgtcaattcagtgaacatgaatatgaatacccttaatgct
atgaatggttatagtatgtcccagccaatgatgaatagtggatatcacagtaatcatggg
tatatgaatcaaactccccagtaccctatgcagatgcagatggggatgatgggaactcag
ccatatgcacagcagccaatgcagacagcaccccacagtaacatgatgtacagtcctccg
gggcatcatggctacatgaacacaggcatgtctaaacagtctcttaatggctcctacatg
agaaggtag

DBGET integrated database retrieval system