KEGG   Meleagris gallopavo (turkey): 100539392Help
Entry
100539392         CDS       T01523                                 

Definition
aldose 1-epimerase-like
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100539392
   00052 Galactose metabolism
    100539392
Enzymes [BR:mgp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100539392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 344 aa AA seqDB search
MAEVKREIFGHMPLEDGGGEVEKFVLQSDSVRVEILSFGCIIAALETRDRAKQFADIVLG
FDTLEGYTRKHPFFGAVVGRVANRIAKGKFTMDGKEYQLFLNNGPNSLHGGARGFDKVLW
SPQILPNGVCFYRLSPDGEEGYPGELKVWVTYTLNGSELAINYRAQTSKKTPISLTNHAY
FNLAGQGSPDIYDHEISIEADSYLPVDDTKIPTGEVAAVQGTGFDLRQPVQLGKHLKQFH
LDGFDHNFCLPLGQTRRLVARAHHPPSGRTMEVHTTQPGLQFYTGNNLDGSLKGKGAAIY
PKHSAFCLETQNWPDAVNKPHFPCPLLLPGEEYNHTTWLCFGTA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggtgaagagagagattttcgggcacatgcccctggaggatggaggaggggag
gtggagaaatttgtgctgcagtcagacagcgtcagagtggaaatcctatcctttgggtgc
ataatcgccgcactggagacaagagacagggccaagcagtttgcagacattgtcctgggc
tttgacactctagaaggctacacaaggaagcaccccttctttggagctgtagtaggtcgt
gttgccaacaggattgccaaagggaagttcaccatggatggaaaagagtatcagctattc
cttaataatgggcccaactcactgcatggaggagccaggggcttcgacaaggttctttgg
agcccccaaatcctcccaaatggcgtctgcttctaccggctcagccctgacggtgaggag
ggctaccctggtgagctgaaggtctgggtcacctacacgctcaatggcagtgagctggct
atcaactatcgagcccagaccagcaagaagacacccatcagcctgacaaaccatgcatac
ttcaacctggcagggcagggctcacctgacatctatgaccatgagatttctattgaagcg
gattcctacttgcctgtggatgacaccaagataccaaccggggaggtggctgccgtgcag
ggcactggctttgacctccgtcagccggtgcagttggggaagcacctgaagcagttccac
ctggatggcttcgatcacaacttctgcctgccactggggcagactcggcgcctcgtggcc
agggctcaccacccgcccagcggcaggaccatggaggttcacaccacccagcctggcctc
cagttctacactggaaacaacctggatggttccctgaagggcaaaggtgctgccatctac
cccaagcactcagctttctgtctggaaacccaaaactggcccgatgctgtgaacaagcct
cacttcccctgccctctgctcctgcccggggaggaatacaaccacaccacctggctgtgc
tttggcactgcctga

DBGET integrated database retrieval system