KEGG   Meleagris gallopavo (turkey): 100539464Help
Entry
100539464         CDS       T01523                                 

Definition
ras-specific guanine nucleotide-releasing factor 1-like
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100539464
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100539464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 1262 aa AA seqDB search
MSKPAAEQPLGADTLEAEHGVFPPVCLRFAHAGSILSIGGNGVSKGEEIPGELGPWQLPL
RALAASEAVWVWSLQGWVCRERRAQRCVDTRSSTAVFLAEPRLSARAALLAHGTSECHWA
PCRVQRGSHCLPPWDPLAHTAGLNAVLTPCLSSAARPGTWHQAGLWHYFTVNFNHENQKT
LELRTEDAKDCDEWVAAIAHASYRTLAMEHEALMQKYLHLLQIVETEKTVAKQLRQQIED
GEIEIERLKAEIASLLKDHERIQSVQSSAPSDDDSDIKKIKKVQSFLRGWLCRRKWKTII
QDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDV
SSIFLNXXXIMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQI
LAHCKQNRDFDKLLKHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVER
NSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQV
PMSEKGKITRGRLGSLSLRKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLI
EEQESTDEDAKASGQDIDHLDFKIVVEPKDASSFTVILVASSRQEKAAWTSDISQCVDNI
RCNGLMMNAFEENSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLER
LTDLRFLSIDFLNTFLHSYRVFTTALVVLDKLITIYKKPISAIPARSLELLFASSQNTKL
LYGEPPKSPRANRKFSSPPPLSITKSSSPSRRRKLSLNIPIITGGKALDLAALSCSSNGY
ASMYSSMGPFSKTTLDINKLYVSSSYPNKIPDEGEAAAEKQEEMLPSKQSSDVSVREESD
TDPNQSDEAEAETSPTKSPTTPMSIKCKNSSDFSLFSYNNGVVMPSCRELDSTRSALSAT
SAFAIATAGANEGTPTKEKYRRMSLASAGFPTDQRNGDKEFVIRRAATNRVLNVLRHWVS
KHSQDFETNEELKYRVISFLEEVIHDPELLTQERKAAANIIRTLTQEDPGDNQTTLEEVV
QMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKNT
KHFNDVSNLIASEILRNEELTARVSAIEKWVAVADICRCLHNYNAVLEITSSLNRSAIFR
LKKTWLKVSKQVGTGRAGGGPQGTPVWSVRAGGAFPKRRLLLRALVDVGASFFSRASRTS
YG
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaccggccgcagagcaaccgctgggtgcagacaccctggaagcagagcatggg
gtttttccacccgtttgcctccgctttgcccacgctggctccatcctctccataggggga
aacggggtcagcaaaggtgaggagattccgggggagctggggccgtggcagctgccgctg
cgtgccctggcagcgtcagaagccgtgtgggtttggagtctgcagggatgggtgtgcaga
gagcgccgtgcacagcgctgcgtggacacacggagcagcaccgcagtgttcctggcagag
ccgcggctgtcagcccgagcagcgcttctggcacacggcacctccgagtgccattgggct
ccatgcagggtgcagcgcggctcgcactgcctgcccccgtgggaccctttggcacacact
gctgggctgaacgccgtgctcactccctgcctgagctctgctgctcggcccggcacgtgg
caccaggctgggctctggcattacttcaccgtgaacttcaaccatgagaaccagaagacg
ctggagctgcgcacagaggatgccaaggactgcgacgagtgggtggcggccattgcccac
gccagctacaggaccctggccatggagcacgaggcgctgatgcagaagtacctccattta
cttcagatcgtggaaacggagaaaactgttgccaagcaactccgacaacagattgaggat
ggggaaattgagatcgagcgcctgaaggcggagatcgcctccctgctgaaggaccacgaa
cgcatccagtcagtgcagagcagcgcgcccagcgatgatgacagcgacatcaagaaaatc
aaaaaggtgcagagcttcctgcgcggctggctgtgccgcaggaagtggaagaccatcatc
caggactacatcaggtccccacacgccgacagcatgcgcaagaggaaccaggtggtgttc
agcatgctggaggccgaggctgaatacgtgcagcagctgcacatcctggtcaacaacttc
ctgcggccgctgcgcatggctgccagctccaagaagccgcccatcacgcacgatgatgtc
agcagcatcttcctcaacnnnnnnnnnatcatgtttttgcaccaaatcttttaccaaggc
ctgaaagcaaggatatccagctggccgacgctcgtgctggccgacctctttgacatcctg
ctgcccatgctgaacatctaccaggagtttgtgcggaaccaccagtacagcctgcagatc
ctggcgcactgcaagcagaaccgcgacttcgacaagctgctgaagcactacgaggccaag
cccgactgcgaggagcgcacgctggagaccttcctcacctaccccatgttccagatcccc
cggtacatcctgacgctgcacgagctgctggcacacaccccgcacgagcacgtggagagg
aacagcctggattacgccaagtccaagctggaggagctctccaggataatgcacgatgaa
gtgagtgagaccgagaacatccgaaaaaatctggcaatagagcggatgatcatcgagggc
tgtgagattctgctggacaccagccagacctttgtacgacaagggtccctcatccaagtg
ccgatgtcagagaaggggaagatcacacgcgggcggctgggctctctgtcactgcgcaag
gagggcgagcggcagtgcttcctcttctccaagcacctgatcatctgcacacgtggctct
ggcggcaagctgcacctcaccaagaatggcgtcatctccctcatcgactgcacgctgatc
gaggagcaggagagcactgacgaggacgcgaaagcttcaggacaggacatcgaccatctc
gacttcaagattgtggtggagccaaaggacgcgtcgtccttcaccgtcatcctcgtggca
tcctccaggcaggagaaggctgcctggaccagcgacatcagccagtgcgtggacaacatc
cgctgcaatgggctcatgatgaatgccttcgaggagaactccaaggtcaccgtgccacag
atgatcaagtctgatgccagcttgtattgtgatgatgttgacattaggttcagtaaaacg
atgaattcctgcaaggtcctccagatccgctatgcaagcgtggaacggctgctggagcgg
ctgacagacctgcgcttcctgagcatcgactttctgaacacgttcctgcactcgtaccgc
gtcttcaccaccgccctggtcgttcttgacaagctcatcaccatctacaagaaacccatc
agcgccatccctgcgcggtccctggagctgctgttcgccagcagccagaacaccaagctg
ctctacggcgagccccccaagtccccccgcgccaaccgcaagttctcctcgccgccgccg
ctctccatcaccaaatcgtcgtcccccagccggcgcaggaagctctccctcaacatcccc
atcatcactgggggcaaagcgctggatctggcggcgctcagctgctcctccaacggctat
gcaagcatgtactcttccatgggccccttcagcaagaccaccctggacatcaacaagctg
tacgtgtccagcagctaccccaacaagatccctgatgaaggggaagcggccgcggagaaa
caggaggagatgctgccaagcaagcagagctcagacgtgtccgtccgggaggagtctgac
accgaccccaaccagagcgatgaggcggaggctgaaacttcaccgacaaaatctccgacc
actcccatgtccatcaagtgcaagaactcctcagatttctccctgttctcctacaacaat
ggtgtggtgatgccgtcctgccgggagctggacagcactcgcagcgccctgtctgccacc
tccgccttcgccatcgccacggcgggcgccaacgaagggacccccaccaaggagaagtac
cggcgcatgtcgctggccagcgcaggcttcccaactgaccagcggaacggggacaaggag
ttcgtcatccggagagcagccaccaacagggtcctcaatgtgctgcgccactgggtctcc
aagcactcgcaggactttgaaacgaacgaagagctgaagtacagggtgatcagctttctg
gaggaggtgattcatgaccccgagctcctgactcaggagaggaaagcagccgcaaacatc
atcagaactctgacacaggaggacccaggggacaaccagaccacgctggaggaagtggtg
cagatggctgagggagtcaaagctgagccctttgagaatcactcggcgctggagatagca
gaacagctgacgctgctcgaccacctggtcttcaagaagatcccctacgaggagttcttc
gggcagggctggatgaagctggagaagaacgagcggacgccgtacatcatgaagaacacg
aagcacttcaatgatgtcagcaacttaattgcgtccgagatcctgcgcaacgaggagctg
acagcgcgcgtcagcgccatcgagaagtgggtggcggtggccgacatctgccgctgcctg
cacaactacaacgccgtgctggagatcacctcctccctcaaccgcagcgcgatcttccgc
ctgaagaaaacctggctgaaggtctccaagcaggtggggacgggcagggcgggcggtggg
ccgcaggggacgccggtttggtcggtccgtgcaggaggggcgttccccaaaaggagattg
ctgctgcgcgcactcgtggatgtgggcgcttctttcttttcgagggcttctcggaccagt
tatggatga

DBGET integrated database retrieval system