KEGG   Meleagris gallopavo (turkey): 100539464Help
Entry
100539464         CDS       T01523                                 

Gene name
RASGRF1
Definition
Ras protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100539464 (RASGRF1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100539464 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 1383 aa AA seqDB search
MQKGMRLNDGHVTYLGLLAKKDGARKGYLSKRSSDNTKWHTKWFALLQNMLFYFETDSSS
RPSGLYLLEGCVCDRAPSPKPSLSAKDSLEKQHYFTVNFNHENQKTLELRTEDAKDCDEW
VAAIAHASYRTLAMEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEIAS
LLKDHERIQSVQSSAPSDDDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLRKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLIEEQESTDEDAKASG
QDIDHLDFKIVVEPKDASSFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNT
FLHSYRVFTTALVVLDKLITIYKKPISAIPARSLELLFASSQNTKLLYGEPPKSPRANRK
FSSPPPLSITKSSSPSRRRKLSLNIPIITGGKALDLAALSCSSNGYASMYSSMGPFSKTT
LDINKLYVSSSYPNKIPDEGEAAAEKQEEMLPSKQSSDVSVREESDTDPNQSDEAEAETS
PTKSPTTPMSIKCKNSSDFSLFSYNNGVVMPSCRELDSTRSALSATSAFAIATAGANEGT
PTKEKYRRMSLASAGFPTDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNEELKY
RVISFLEEVIHDPELLTQERKAAANIIRTLTQEDPGDNQTTLEEVVQMAEGVKAEPFENH
SALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKNTKHFNDVSNLIASEI
LRNEELTARVSAIEKWVAVADICRCLHNYNAVLEITSSLNRSAIFRLKKTWLKVSKQTKA
LIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFSK
MRMISHIIREIRQFQQTSYKIEHQPKVTQYLLDQSGVMDEEALYGASLRMEPKLPSRAGR
FAPAVHSCVFPLDAGVPLSPPVCASPSSPAPPALRPRVGFPASFKVSRIHTSPGVPVSFP
RCSFCHSFPSRGLGAAGGRGSSPVRCAVAAPRCAPSSCPSCQPAPFHDVELAEDDRVFLL
HIL
NT seq 4152 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggggatgcggctcaatgacgggcacgtcacctacctggggctgctggcgaag
aaggacggcgccaggaagggctatctgagcaagcggagctccgacaacacaaaatggcac
accaagtggttcgcgctgctgcagaacatgctcttctacttcgagaccgactccagctcc
cggccctcggggctctacctgctggagggctgcgtctgcgaccgggcgccctcccccaag
ccctccctctcggccaaggactccctggagaagcagcattacttcaccgtgaacttcaac
catgagaaccagaagacgctggagctgcgcacagaggatgccaaggactgcgacgagtgg
gtggcggccattgcccacgccagctacaggaccctggccatggagcacgaggcgctgatg
cagaagtacctccatttacttcagatcgtggaaacggagaaaactgttgccaagcaactc
cgacaacagattgaggatggggaaattgagatcgagcgcctgaaggcggagatcgcctcc
ctgctgaaggaccacgaacgcatccagtcagtgcagagcagcgcgcccagcgatgatgac
agcgacatcaagaaaatcaaaaaggtgcagagcttcctgcgcggctggctgtgccgcagg
aagtggaagaccatcatccaggactacatcaggtccccacacgccgacagcatgcgcaag
aggaaccaggtggtgttcagcatgctggaggccgaggctgaatacgtgcagcagctgcac
atcctggtcaacaacttcctgcggccgctgcgcatggctgccagctccaagaagccgccc
atcacgcacgatgatgtcagcagcatcttcctcaacagcgaaacgatcatgtttttgcac
caaatcttttaccaaggcctgaaagcaaggatatccagctggccgacgctcgtgctggcc
gacctctttgacatcctgctgcccatgctgaacatctaccaggagtttgtgcggaaccac
cagtacagcctgcagatcctggcgcactgcaagcagaaccgcgacttcgacaagctgctg
aagcactacgaggccaagcccgactgcgaggagcgcacgctggagaccttcctcacctac
cccatgttccagatcccccggtacatcctgacgctgcacgagctgctggcacacaccccg
cacgagcacgtggagaggaacagcctggattacgccaagtccaagctggaggagctctcc
aggataatgcacgatgaagtgagtgagaccgagaacatccgaaaaaatctggcaatagag
cggatgatcatcgagggctgtgagattctgctggacaccagccagacctttgtacgacaa
gggtccctcatccaagtgccgatgtcagagaaggggaagatcacacgcgggcggctgggc
tctctgtcactgcgcaaggagggcgagcggcagtgcttcctcttctccaagcacctgatc
atctgcacacgtggctctggcggcaagctgcacctcaccaagaatggcgtcatctccctc
atcgactgcacgctgatcgaggagcaggagagcactgacgaggacgcgaaagcttcagga
caggacatcgaccatctcgacttcaagattgtggtggagccaaaggacgcgtcgtccttc
accgtcatcctcgtggcatcctccaggcaggagaaggctgcctggaccagcgacatcagc
cagtgcgtggacaacatccgctgcaatgggctcatgatgaatgccttcgaggagaactcc
aaggtcaccgtgccacagatgatcaagtctgatgccagcttgtattgtgatgatgttgac
attaggttcagtaaaacgatgaattcctgcaaggtcctccagatccgctatgcaagcgtg
gaacggctgctggagcggctgacagacctgcgcttcctgagcatcgactttctgaacacg
ttcctgcactcgtaccgcgtcttcaccaccgccctggtcgttcttgacaagctcatcacc
atctacaagaaacccatcagcgccatccctgcgcggtccctggagctgctgttcgccagc
agccagaacaccaagctgctctacggcgagccccccaagtccccccgcgccaaccgcaag
ttctcctcgccgccgccgctctccatcaccaaatcgtcgtcccccagccggcgcaggaag
ctctccctcaacatccccatcatcactgggggcaaagcgctggatctggcggcgctcagc
tgctcctccaacggctatgcaagcatgtactcttccatgggccccttcagcaagaccacc
ctggacatcaacaagctgtacgtgtccagcagctaccccaacaagatccctgatgaaggg
gaagcggccgcggagaaacaggaggagatgctgccaagcaagcagagctcagacgtgtcc
gtccgggaggagtctgacaccgaccccaaccagagcgatgaggcggaggctgaaacttca
ccgacaaaatctccgaccactcccatgtccatcaagtgcaagaactcctcagatttctcc
ctgttctcctacaacaatggtgtggtgatgccgtcctgccgggagctggacagcactcgc
agcgccctgtctgccacctccgccttcgccatcgccacggcgggcgccaacgaagggacc
cccaccaaggagaagtaccggcgcatgtcgctggccagcgcaggcttcccaactgaccag
cggaacggggacaaggagttcgtcatccggagagcagccaccaacagggtcctcaatgtg
ctgcgccactgggtctccaagcactcgcaggactttgaaacgaacgaagagctgaagtac
agggtgatcagctttctggaggaggtgattcatgaccccgagctcctgactcaggagagg
aaagcagccgcaaacatcatcagaactctgacacaggaggacccaggggacaaccagacc
acgctggaggaagtggtgcagatggctgagggagtcaaagctgagccctttgagaatcac
tcggcgctggagatagcagaacagctgacgctgctcgaccacctggtcttcaagaagatc
ccctacgaggagttcttcgggcagggctggatgaagctggagaagaacgagcggacgccg
tacatcatgaagaacacgaagcacttcaatgatgtcagcaacttaattgcgtccgagatc
ctgcgcaacgaggagctgacagcgcgcgtcagcgccatcgagaagtgggtggcggtggcc
gacatctgccgctgcctgcacaactacaacgccgtgctggagatcacctcctccctcaac
cgcagcgcgatcttccgcctgaagaaaacctggctgaaggtctccaagcagacgaaggct
ctgatcgacaagctgcagaagctggtgtcctcagagggcaggttcaagaacctgagggag
gcgctgaaaaactgcgaccccccgtgtgtgccctacctggggatgtacctgaccgacctg
gccttcatcgaggagggcaccccaaactacactgaggacgggctggtgaacttctccaaa
atgaggatgatttcccacatcatcagagagatccgccagttccagcaaacttcctacaag
atcgagcaccagcccaaggtgacgcagtacctgctggaccagtctggagtgatggacgag
gaggccctgtatggggcttccctgcggatggagcccaagctgccttcccgagccgggcgc
ttcgcccccgctgtacatagctgtgtgttcccgttggatgccggagtgcccctctccccc
cccgtgtgcgcttcccccagcagccccgccccccccgctcttcggccccgcgtaggattc
cccgcatcctttaaggtttcgcgcatccacacttcgccgggggtcccggtttcttttcca
cgatgttctttttgtcattcgttcccctccagagggctgggggcagcgggggggcgcggc
tccagccccgtgcgctgtgcagtggctgcaccccgctgtgctcccagctcgtgcccctcg
tgccagcccgccccgttccacgacgtagagttagccgaagatgaccgagtgtttttatta
catatactgtaa

DBGET integrated database retrieval system