KEGG   Meleagris gallopavo (turkey): 100539467Help
Entry
100539467         CDS       T01523                                 

Gene name
EIF4E1B
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 1B
  KO
K03259  translation initiation factor 4E
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03013  RNA transport
mgp04150  mTOR signaling pathway
mgp04910  Insulin signaling pathway
Module
mgp_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100539467 (EIF4E1B)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100539467 (EIF4E1B)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100539467 (EIF4E1B)
Messenger RNA biogenesis [BR:mgp03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100539467 (EIF4E1B)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100539467 (EIF4E1B)
Translation factors [BR:mgp03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100539467 (EIF4E1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 100539467
NCBI-ProteinID: XP_003210396
Ensembl: ENSMGAG00000004602
Position
15
AA seq 211 aa AA seqDB search
MASGEQRRQEERRRRRAQQQELQVAESLGKHPLQNRWALWFFKNDKSKMWQANLRLVTKF
STVEDFWALYTHIQLASKLTSGCDYSLFKDGIEPMWEDSQNKRGGRWLITLAKQQRHTEL
DRFWLETLLCLIGEMFDEYSDEVCGAVINIRAKGDKIAIWTREAENREGVTHIGRIYKEH
LGLSQKVAIGYQAHADTATKSGSLTKNKFVV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggggagcagaggagacaggaggagcggcgcaggcgcagggctcagcagcag
gagctgcaagtggcagagagcctgggcaagcacccactgcagaacagatgggccctgtgg
ttcttcaagaatgacaagagcaagatgtggcaggccaatctacgcctggtcaccaagttc
agcacggtggaggacttctgggcgctgtacacccacatccagctggccagcaagctgaca
tcgggctgtgactattccctcttcaaggacggcatcgagcccatgtgggaggacagccag
aacaagcgtggtgggcgctggctcatcaccctcgccaagcagcagaggcacacggagttg
gaccgcttctggctggagacgctcctgtgcctcatcggggagatgttcgatgagtacagc
gatgaggtgtgcggggccgtcatcaacatccgtgccaagggggacaaaatcgccatatgg
acccgggaggcggagaaccgggagggggtcacccacatcgggcgcatctataaggagcac
ttggggctgtcgcagaaggtggccatcgggtaccaggcgcacgcggacacggccaccaag
agcggctccctcaccaagaacaaatttgttgtgtga

DBGET integrated database retrieval system