KEGG   Meleagris gallopavo (turkey): 100539573Help
Entry
100539573         CDS       T01523                                 

Definition
bcl-2-like protein 1-like
Orthology
K04570  
BCL2-like 1 (apoptosis regulator Bcl-X)
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Apoptosis
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100539573
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100539573
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100539573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
22
AA seq 229 aa AA seqDB search
MSSSNRELVIDFVSYKLSQKGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHV
VNGAAVHRSSLEVHEIVRASDVRQTLRDAGDEFELRYRRAFSDLTSQLHITPGTAYQSFE
QVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMRVLVGRIVSWMTTYLTDHLDPWIQE
NGGWERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcagtaaccgggagttagtgattgactttgtttcctacaagctctcgcagaag
gggcactgctggagcgagctggaggaagaggatgagaacaggactgacactgcagcagag
gcagagatggacagcgtcctcaatgggagcccatcctggcacccgcctgccggccacgta
gtgaatggagccgccgtgcacaggagcagcctggaagttcatgaaattgttcgagcatct
gacgtgaggcagacgctgagagatgcaggggatgagtttgagctgaggtaccggagggct
ttcagcgatctcacctcccagctccacatcacccctggcacggcgtaccagagctttgag
caggtagtgaacgaactcttccatgatggtgtgaactgggggcgcatcgtggctttcttc
tccttcggaggggctttgtgcgtggagagcgtggacaaggagatgcgggtactggtggga
cgcattgtgtcttggatgaccacgtacttgaccgaccatctagacccctggatccaggag
aatggcggctgggagcgctttgtggacctgtatgggaataatgctgctgccgagctgagg
aagggccaggagaccttcaacaaatggctcctgaccggggcgaccgtggccggagtgctt
ctgctgggatccctgctgagccgcaagtga

DBGET integrated database retrieval system