KEGG   Meleagris gallopavo (turkey): 100539635Help
Entry
100539635         CDS       T01523                                 

Gene name
STAMBP
Definition
(RefSeq) STAM binding protein
  KO
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100539635 (STAMBP)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100539635 (STAMBP)
Peptidases [BR:mgp01002]
 Metallo Peptidases
  Family M67
   100539635 (STAMBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 431 aa AA seqDB search
MCLVMPNHADVSLPPEERVRSLIQVGSAVEVSEDVPPRRYYRSGVEILRMATVYSEEGNI
EHAFILYNKYITLFIEKLPKHRDYKTAVVPERKETMKKLKEVAFPRAEDLKKELLQRYTK
DYTKYIEQKKEKEEEDARNLALQQQLEEERNRVALMKQQQAEQEQFLAFEEMIRRQELEK
ERLRIVQEFGKQEPSPESLDGPLIPGMEKPATDLTPRVPVSPLHPASPSVGTVSSKPPVV
DRSLKPSALGSTEHTAGMEALRQVIVPRELCHKFLQLADANTARGVETCGILCGKLMRNE
FTITHVIIPKQYGGPDYCNTENEEELFLIQDQHGLVTLGWIHTHPTQTAFLSSVDLHTHC
SYQMMLPESIAIVCSPKYQETGFFKLTEHGLEEISSCRQKGFHPHPKDPPLFTTCNHVSV
VERDVVLMDLR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctcgttatgcccaaccatgctgatgtcagcctcccgccagaggagcgtgtccga
agcctgatccaggtggggagtgctgtggaagtgagtgaggatgtcccaccacgacgctac
tatcgctccggcgtggagatcctccgcatggccaccgtttactcagaggagggcaatatt
gagcatgccttcatcctgtacaacaagtacatcacgctcttcattgagaagctgccaaag
caccgtgattacaaaactgccgtcgtacctgaaaggaaggagacaatgaaaaagctgaag
gaagtagcctttcccagagctgaagacctcaagaaggagctgttgcagaggtacacgaag
gactacactaagtacatcgagcagaagaaagagaaggaagaggaggatgcacgcaacttg
gctttgcagcagcagttggaagaggaaagaaatcgtgtagccttaatgaagcagcagcag
gcagagcaagagcagtttcttgccttcgaggagatgattcgacgacaggagctggaaaag
gaacgtttgaggatagtgcaggaatttggaaagcaggagccaagtcctgagtctctggat
ggacccctcatccctggcatggaaaagccagctactgatttaaccccaagggttcctgtc
tctccacttcaccctgcgagtccatcagtggggactgtctcatccaaacctcctgttgtg
gacagatctttgaaacctagtgctttggggagcacagaacacactgcaggtatggaagcc
cttcgccaggtcattgtccccagagagctgtgccataaattcctccagctggctgatgcc
aacacggcccgaggtgtggagacctgtgggatcctctgtggtaagctgatgaggaatgaa
ttcaccataacccacgtcatcattcccaagcaatatggaggccctgattattgcaacaca
gagaatgaggaagaactcttcctgatccaggaccagcatggcctcgttacactcggctgg
atccatactcaccccacacagacagctttcctctccagcgtcgacctgcacacacactgc
tcctaccagatgatgctgccagagtccatcgctattgtgtgttctccaaagtaccaggag
acagggtttttcaagctgacagaacacggcctggaggagatctcttcttgtcgacagaaa
ggattccacccacaccccaaggaccctcctctcttcactacttgcaatcatgtgtcagta
gtcgagagagatgtggtgctgatggatctacgatag

DBGET integrated database retrieval system