KEGG   Meleagris gallopavo (turkey): 100539732Help
Entry
100539732         CDS       T01523                                 

Gene name
ASH1L
Definition
ash1 (absent, small, or homeotic)-like (Drosophila)
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Lysine degradation
Tight junction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100539732 (ASH1L)
 Cellular Processes
  Cell communication
   04530 Tight junction
    100539732 (ASH1L)
Enzymes [BR:mgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100539732 (ASH1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
27
AA seq 2974 aa AA seqDB search
MDPRNTAMLGLGSDSEGFSGKSPSLVNIGTLVGKGDVDLESCTKEEEDGEKNREGNGVEN
GKKEALVDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTSIKQPR
RPPKSGKMTDEKNEHCPSKQDPSKSYKKAGEVTTVELHVEEGIQVETNPLPKKVSPLHTE
MTDYIKSSPPTLISSHNSDLKDRTQINGATTVTEKLAQLIATCPPSKSSKTKQKKPGSGT
ASGLVKDSGKKLPGTIPASGVVNKDLVKKLPGSGIAVGLVSKDSGKKPLGIVTSSAVGLI
NKDAGRKFPGISTPTGLTNKESAKKPAGISAPAGLINKDAGKKLLGISSPAGLVSKDTGR
KMPGTGNATALANKDSGRKTPGIGSPVGPVNKDSGRKIVGISSPVGLVNKDSGKKPTGIS
TPVGLVNKDSGTLKADSLMPASEPFKLPCNSNLSSLESHDTTDLLKENTSSKTFEKHIVR
QSKESILEKFSIRKEIADVGKEMFNEGICVPQDGYTASEKGIYETSKHEKQPPVYCTSPD
FRTGGASDVSTAKSPFSAVGEGNLPSPSPTVSVTTLNRSLSAASSQLASNTLHLSSTADL
LEGISDQIGKTQFSPDSTLLNINRTLNHSLSTDFKGADKDLGDSKASYVETSRTSPSIGK
KPILAAETSIHATVTPSVVSFTSLFSSKQFLKIGAIAASDKSCQGAKNLSTSQQSKPLKK
RKGRKPRWTKVVSRSTCRPPKGLELERSELFKNISYSALSSSNLEQAKFLKNIGSSSFVE
HEFVKHQLPKLNEGSGQPLALLSESDKQTQKFYSAHKQPSSLCMSDDFLPDMYKPKRGRP
KSKEMPELEGPPKRTLKIPASKVFSVQSKEEQEPPILQPEVEIPSLKQSLSGQAFPKKRG
RPKRQMRSSIKMKPPILSVAPFVGTESSSKIESESDQHRSGDFYERKDQLRGPEEVQKPN
ICSMSDLEVDSDRKVAKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSTVEPNNKGKVQ
SKLHNTVSTLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKAVLNGILTSNSASLTVLEK
SSQQTPGTSFGQVLPHLLPSAANSSEILPSPVCSQSSAVSGGQSPVSSDAGFIEPSSVPY
LHIHSRQGSVVQTLAMKKAAKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPVSESHSDE
TIPSDSGIGTDNNSTSDRAEKFCGQKKKRHSFDHVSLIAPEASTVLSNLKEKHKHKCKRR
SHDYLSYDKMKRQKRKRKKKYPQLRGRQDPDFLAELEELISRLSEIRITHRSHHFIPRDL
LPTIFRINFNSFYTHPTFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSS
TGFYPSYGMPYSPSPLAAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHTGHLLLN
PTKYHKKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMLEHKHRHRHKHREHRTS
EQPQVSMDTITANSSSRTVLESLKRYRFGKEAVGERYKHKEKHRCHMSCPHLSPSKGLLS
RDEQWVRREPSESNSLALGLQTPLQIDCSDSSPGLSLGGFTPSSEPASSDEHTNLFTSAI
GSCRVTNSTSTNGRKKLTDSPGLFSAQDSSLNRPLRKEPLPSIEKALQPLSGTLPTQDKP
SQRQSESTNCSPSRKRSTSESTSSTVIGVPTRGTRLTAADDSVDSLLQRMAQHEGQAALD
KSIEAVIANVSVPPSASPARNHNRERSLGKQDSLVAPAIPSSSCSDSISLLSDRLPNSYS
PHHLKRSVVEAMQRQARKMCNYNKILATKKNLDHVNKILKAKKLQRQSRTGNNFVKRRPG
RPRKYPMQAVVSMQAFQAARLVSQELDKREESSSPLHLGPDTITDVIEAVVQSVNLNPDH
RKGWKRKRWLSEEQARKRQKPLPEDEQESSKSFSETPPEPPSPQDALGKPPEPENTQQQQ
PLPSLPQREKKAPRPPKKKYQKAGLYSDVYKTADPKSRLIQLKKEKLEYTPGEHEHGLFP
APIHVGKYLRQKRIDFQLPYDILWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPLSGYEAT
TCNCKKPDDENGKGCMEDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEE
KGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRM
GNEARFINHSCNPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCK
CGFEKCRGIIGGKSQRVNGLPNKSNQPVSSHRRTGRSKEKRKSKHKLKKRRGHMPEEPSE
SVNAPTRLTPQLQMKPMSNRERNFVLKHHVFLVRNWEKIRQKQEEVKQVSDNIHTASLYS
RWNGICRDDGNIKSDVFMTQFSALQTARSVRTRRLAAAEENIEVARAARLAQIFKEICDS
IIAYKDSSRQALAAPLLNLPPKKKNADYYEKISDPLDLATIEKQILTGYYKTVEAFDGDM
LKVFRNAEKYYGRKSPTGRDVCRLRKAYYNARHEASAQIDEIVGETASEADSSETSVCEK
ENGHEKDEDVIRCICGLYKDEGLMIQCEKCMVWQHCDCMGVNSDVEHYLCEQCEPRSVNR
EVPMIPRPHYTQPGCVYYICLLRDELLLRQGDCVYLMRDSRRTPDGHPVRQSYRLLSHIN
REKLDIFRIEKLWKNEKEERFAFGHHYFRPHETHHSPSRKFYHNELFRVPLYEIIPLEAV
VGTCCVLDLYTYCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFDHFP
KRLTPKRDFSPHYVPDNYKRNGGRSSWKSDRAKQQIKDLNQEEEPLPLMEDVLGNQEQAG
SEAPSLEEPEKEAVPNESSETEKKAEEGTADTRQPCSPEERRHIQRERLNQILLNLLEKI
PGKNAIDVTYLLEEGSGRKLRRRTLSIPDSSFRK
NT seq 8925 nt NT seq  +upstreamnt  +downstreamnt
atggaccctcggaatactgctatgttaggcttgggctctgattctgaagggttttctggg
aaaagcccctctttggtaaacattggcacgttggtgggaaagggagacgtagacctggaa
agctgcaccaaggaagaggaggacggtgagaagaatcgggaggggaacggtgtggagaat
gggaagaaggaggctctggttgatgcacagcaacagttttcagtgaaagaaacaaacttt
tcggagggaaacttgaaactgaagattggtctccaagcaaagagaacaaaaaagcctcct
aagaacctcgagaattatgtgtgccggcctgccataaaaaccagcatcaagcaaccacga
aggccaccaaagagtgggaagatgacagatgagaagaatgagcactgtccttcaaaacaa
gacccttcaaagtcgtacaagaaagctggagaagttacaacagttgaattacatgtggaa
gaaggtatacaagtagaaacaaatcccttacctaagaaagtttccccattgcacactgaa
atgacagattatataaagtcatctcctccgactcttatcagtagccataattctgactta
aaggatagaacacagattaatggagcaacaactgtaacagagaaattggctcaacttatt
gcaacttgtcctccttcaaagtcttccaaaacgaagcagaagaagcctggaagcggaact
gcatctggtttggttaaagactctgggaagaagctgccgggaaccattcctgcaagtggg
gtagttaataaagatttggtaaagaaattgccaggatctggtattgctgttggattggtc
agtaaggactcagggaagaagccattagggattgtgaccagctctgcagttggattaatt
aacaaagatgctgggaggaagtttccaggtatcagcactccaaccggattgactaataag
gagtctgcaaagaagccagcggggatcagcgctccagctggactgattaacaaggatgct
gggaagaagttgctgggaataagtagtcctgcaggattggttagcaaggatactgggagg
aaaatgccggggactggcaatgccacagccctggctaacaaagactctggtaggaagaca
ccagggattggcagcccagtgggcccggttaacaaggactctgggaggaagatagtaggc
attagcagtccagtgggattggttaacaaggactctggaaagaagccaacgggaatcagc
actccggtgggtttggttaacaaggactccggaactctgaaagcagactccctcatgcct
gcctcagagccctttaagcttccttgcaattcaaaccttagcagccttgaaagccacgat
actacggatttactgaaagaaaatactagcagcaaaacatttgagaagcatattgtgagg
cagagcaaagaaagtatcttggaaaaattttcaattcggaaagaaatcgctgatgtaggt
aaagaaatgtttaatgaaggaatctgcgtcccacaggatggttacacagccagtgagaaa
gggatttatgaaacatctaagcacgaaaaacagcctccagtctattgcacttcaccagac
ttcaggacaggaggtgcttcagacgtgtccacagccaagtccccatttagtgcagtagga
gaggggaatctcccgtcgccttcacccacagtgtctgttaccaccttaaacaggagcctc
tcagcagcatcttcacagttagcgtccaacacgctgcatctgagttccacggctgatctc
ctagaaggtatttcagatcagattggcaagactcagttttctcccgacagcacgcttcta
aatataaacagaacgttgaaccatagtctgagcaccgattttaaaggtgctgataaagac
ctaggtgattcaaaagcttcttacgtagaaacttcaagaactagcccttctatagggaaa
aaacccattttggcagctgaaacaagcattcatgctactgtcaccccttcggtagtgagt
tttacaagcttgtttagtagcaagcagttcctaaagatcggtgcaatagctgcatcagat
aaatcctgccaaggagcaaaaaatctgagcaccagtcagcaatccaaacctttaaagaaa
agaaaaggaaggaagccacgatggactaaagtggtgtcgagaagcacatgccggcctcca
aagggtctagaactagaaaggtcagagctttttaaaaacatttcatacagtgcactatcc
agcagtaatttggagcaggccaaattcttaaaaaacatcggatcgtcttcgtttgtggag
cacgaatttgttaagcatcagctgccaaaactgaatgagggcagtgggcagcctcttgca
ctgctcagtgagtctgacaagcagactcaaaagttctacagtgctcacaaacaaccttcg
agtttgtgcatgtcggacgatttcttacctgacatgtataaacccaaaagaggaagacct
aaatccaaggagatgccggagcttgaaggtccccccaaaagaactctgaagatcccagca
tcaaaagtcttttcagtgcagtcaaaagaagagcaagaacctcccattttgcagcccgag
gtggaaattccttccctaaagcagagtttatcgggacaagcttttcctaaaaagagaggg
agacctaaaaggcagatgaggtcatcgattaaaatgaagccaccgattctttctgtggca
ccttttgttggaacagagagctcaagcaagatagagtctgaaagcgatcagcatcggagc
ggggatttttatgagagaaaggaccagctccgagggccagaagaagtccaaaaacctaat
atttgtagcatgagtgatttggaagtagactcagacagaaaagttgccaagagaaacaac
gggcagttaatgaaaacaattattcgaaaaataaataaaatgaaaactttgaagagaaag
aaacttttgaatcagattctctcgagtacggtggaaccaaataacaaagggaaagtgcaa
tccaagctccacaacacggtgtcaactcttgctgccacttttggttcaaaattaggccag
caaataaatgtcagcaagaaaggaacgatttatataggaaaaaggagaggaaggaaaccc
aaagctgtcctgaacggtattttaactagcaattctgccagcctgacagttcttgagaag
tcttctcagcaaactcccgggacgtcgtttggccaagtacttccccacctgctgccttca
gcagctaatagttccgagatcctcccgtcccccgtttgctctcagtcctctgcagtcagt
ggggggcagagccccgtcagcagcgacgcggggttcattgagcccagctcggtgccgtac
ttgcacatccactccaggcaaggaagcgttgttcagacactcgcaatgaagaaagctgct
aagggaaggaggagattatctccacccacattgttgccaaactctccttctcacttgagc
gagctgacatcgctgaaagaagccactccttcccccgtgagcgaatctcacagcgatgag
accattcccagtgacagtggaataggaacagataacaacagcacttcagatcgagctgag
aaattctgtgggcagaagaaaaagaggcattccttcgatcacgtttccctcattgcaccc
gaagcttccacggttttaagtaacctcaaagaaaagcataaacacaaatgcaagcgccgg
agtcacgattacctcagttacgacaaaatgaagaggcagaagcgaaaaaggaaaaagaaa
tatcctcagcttcgaggtaggcaggacccggatttcctggctgaattggaagaattaatc
agtcgactaagcgaaatcagaatcacccacagaagtcaccattttataccccgcgatctc
ctgcctaccattttccgaatcaatttcaacagtttctatactcaccctacttttccttta
gatccgttgcactacattaggaaacccgatttaaagaagaagagaggcaggcctccgaaa
atgcgggaggctatggcagaaatgcctttcatgcacagcctcagcttccctctctctagc
accgggttctatccctcctacggcatgccttactctccttcccccctcgcagctgctccc
ataggtttaggttactacggaaggtaccctccgactctttatcccccaccaccttctcct
tctttcaccaccccgctgccaccaccctcctacatgcacacaggccatttgcttctcaat
cccaccaaataccacaagaaaaagcataaacttttgcgccaggaagctttcctcaccacg
agtcggactccgctcttgtccatgagcacgtaccccagcgttccacctgagatggcttac
ggctggatgctggaacacaagcacaggcaccgccacaaacacagagagcatcgtacttcc
gagcagccgcaggtttccatggacaccatcacggctaatagctcttccagaacagttctg
gagtccttgaagcgctacagattcgggaaggaggctgtcggtgagaggtacaaacataag
gagaaacacagatgtcacatgtcttgtccccacctgtcgccttcaaagggattgctaagc
agagatgaacagtgggtccggagggagccttcggagtctaattccttagcactgggattg
cagacacccttacagatagactgctcagacagctccccaggtctgtccctggggggattt
actcccagctccgagccggccagcagcgacgaacacacaaatcttttcacaagtgcaata
ggcagctgcagagtcacaaactctaccagcaccaatggacgtaaaaagctaactgacagc
cctggactcttcagtgcacaggacagctcgctaaatcgaccgctgcgaaaggaaccgttg
ccttctattgagaaggcactgcagcctctgtcaggcactctgccaacacaggacaaacct
tcccagaggcagtcagagagcacaaattgcagcccttccagaaagagatcaacatctgag
agcacatcttctacagtgatcggagtgccgacgcgggggacaaggctgacagctgctgat
gattctgtggacagcttgctgcagcgcatggcgcagcacgaaggccaggctgctttggac
aaaagcatagaagcagtcattgcgaacgtgtccgttccaccgtcagctagtcctgctcga
aaccacaacagggagaggagtctggggaagcaggacagcctcgttgctccagccatccca
agcagctcctgcagtgacagtatctcgcttctgtcagacagattaccgaacagctattcc
ccacatcatctcaagagaagcgtggttgaagccatgcagcgacaagctagaaaaatgtgc
aattataacaagatcttggcaacaaaaaaaaatcttgaccacgtcaataagattctgaaa
gccaaaaagctgcaaaggcagtcacggacagggaataattttgtgaaacgcaggccaggt
aggcccaggaaatacccaatgcaggctgttgtgtccatgcaggccttccaggcagctcgg
ctggtcagtcaggagttagataagagggaagaaagcagcagtcctttacacctcgggcct
gataccatcactgatgtgattgaagctgtggtgcaaagcgtaaacttgaatccagatcac
cgaaaaggatggaagagaaagaggtggctctcggaggaacaggccaggaaacgacaaaaa
cctctgccagaagatgaacaggagagcagtaagagcttttctgagacaccacctgaacca
cccagtcctcaggatgcccttgggaaaccacctgaacctgagaacacccaacagcagcag
cctttgccctctcttccccagcgtgagaagaaagccccccggcccccaaagaagaagtac
cagaaggcagggctctactctgacgtgtacaaaacagcagatccgaagagccgcctcatc
cagctgaagaaggagaagctggaatacactcctggagagcacgagcacgggttgtttcca
gccccaattcatgtcggaaagtatctcagacaaaagagaattgacttccagctgccttac
gacatcctctggcagtggaaacacaatcagctgtataaaaagccagatgtcccactttat
aaaaaaatccgctccaatgtctacgtggatgtcaaacctctctctggctacgaagccact
acctgtaactgcaagaaaccagatgatgagaatggcaagggctgcatggaggattgcctt
aacaggatgatcttcgctgagtgttcaccaaacacctgcccttgtggtgagcagtgctgt
aaccaacggatccagaggcacgaatgggtgcagtgcttggagaggttccgggctgaggag
aagggttggggtatccgcaccaaagagcccctgaaagcaggacagttcatcatcgaatac
ctgggagaagttgttagtgagcaagaattcaggaaccggatgattgagcagtaccataac
cacagtgatcattactgcctgaatttggacagtggaatggtgatagatagttaccgcatg
ggcaacgaggctcgtttcatcaaccacagctgtaatccaaactgtgagatgcagaaatgg
tctgttaatggtgtttaccggattggattgtatgcacttaaagatatgcctgctggtacc
gaactgacctacgactacaacttccactcatttaatgttgaaaagcagcaactctgcaag
tgtgggtttgagaaatgcagagggataattgggggcaaaagtcagcgagtgaacggactt
ccaaacaaaagcaaccagcctgtgagcagccacaggaggaccgggaggtcgaaggagaag
aggaagtccaagcacaaactgaagaagagaaggggccacatgccggaggagcccagcgaa
agcgtgaacgcacccaccaggctgacaccacagctgcagatgaagcccatgtctaacaga
gaaaggaattttgtgttaaaacaccacgtgtttctggtgcgaaactgggaaaagattcga
caaaagcaagaggaagtgaagcaagtcagtgacaacatccatacggcgtcgctgtacagt
cgctggaatggaatctgtcgggatgatggcaacatcaaatctgatgttttcatgacccag
ttctcagcccttcagaccgcccgctcggtccggacgcggcgtttggctgcagctgaagag
aacatcgaagtggctcgtgctgcccgcctggcacagatcttcaaggagatttgtgacagc
atcatagcctataaagattcctccaggcaggctctggcagctcccctcctgaacctgccc
ccaaagaagaaaaacgcagactattacgaaaagatctccgacccactggaccttgccacc
attgagaaacagatcctgactggctattacaaaactgtggaagcttttgatggggacatg
ctgaaggtctttcggaacgcagagaaatattacggcaggaagtctccaaccggccgtgat
gtgtgcaggctgcggaaggcgtattacaacgcccgccacgaggcctctgcccagattgat
gagatagtgggagagacagcgagcgaggctgacagcagtgagacttcagtctgcgagaag
gagaatgggcacgagaaggatgaagatgtcatccgctgcatctgtggcctttacaaagat
gaaggactcatgatccagtgtgagaagtgcatggtctggcagcactgtgactgtatgggt
gtgaattctgacgtggagcactacctgtgtgagcagtgtgagcctcgatccgtgaacagg
gaggttcccatgattccccggccccattacacccagcctggctgtgtgtattacatctgc
ttgttgcgggacgagctgctgctgcgccaaggtgattgtgtttacctgatgagagacagc
cgcagaactccagacggacacccggtccggcagtcctacaggctgctgtcccacatcaac
agggagaaactcgatattttccgcattgaaaaactctggaaaaatgagaaagaggaacgc
tttgcatttggtcatcattatttccgtccacatgaaacacatcattccccttctcgaaag
ttttatcacaatgagctgttccgggtgccattgtatgaaattatccccttagaggctgtg
gtgggaacgtgctgtgttcttgacctgtacacctactgcaaagggaggccaaaaggtgtg
aaggagcaggacgtgtacatctgtgattaccgcctggataaatcagctcatctcttctac
aagatccaccgcaatcgttaccccgtctgcaccaagccctatgccttcgaccacttcccc
aagagactcactcccaagagagacttctctccccactatgtaccagacaactacaagagg
aatggaggcaggtcatcctggaaatcggatcgcgcgaagcaacagatcaaagacttgaac
caggaggaagaacctcttccgctcatggaggacgtgttaggaaaccaggagcaagctggg
agtgaggctccaagcctggaggagccagagaaagaggcagttcccaacgagagctctgaa
acagagaaaaaagcagaagaaggcactgctgacacacggcagccgtgcagtccggaggag
aggcggcacatccagagagagagactcaatcaaatcctcctcaacctcttagagaaaatc
ccagggaaaaacgctattgatgtcacgtatttgctggaggaaggatcgggaagaaaactg
aggagacgcactctgagcatcccggatagcagcttcagaaagtga

DBGET integrated database retrieval system