KEGG   Meleagris gallopavo (turkey): 100539801Help
Entry
100539801         CDS       T01523                                 

Gene name
UGP2
Definition
UDP-glucose pyrophosphorylase 2
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100539801 (UGP2)
   00052 Galactose metabolism
    100539801 (UGP2)
   00500 Starch and sucrose metabolism
    100539801 (UGP2)
   00520 Amino sugar and nucleotide sugar metabolism
    100539801 (UGP2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100539801 (UGP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 509 aa AA seqDB search
MYFIFIEDFSKAMSQAGPSQFQEVIRQELEYSMKVELDKILATAPSNELEHTKKDLEGFK
KLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNIASVLNKLVVVKLNGGLGT
SMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYS
HTRVKIYTFNQSRYPRINKETLLPIAKDVSYSGENTECWYPPGHGDIYGSFYNSGLLDNL
IAEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYE
NKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWIALSAIKRLQEKNAIDMEIIVNPKTL
DGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMS
EKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIII
ANHGDRIDIPAGAVLENKIVSGNLRILDH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtatttcattttcattgaagatttcagcaaagcaatgtcccaggctggcccgtcgcag
ttccaggaagtcattcggcaagagctggagtattccatgaaagtagaacttgataaaata
cttgcgactgcgccctcaaatgagctagagcacactaaaaaggacctggaaggatttaag
aagctatttcatagattcctacaggagaagggaccatctgtggactgggggaagattcag
agaccaccagaagattctatccagccctatgagaagataaaggccagaggactgcccgat
aacattgcttctgtcttgaacaagctggtggttgtgaaactaaatggcggcttgggcaca
agcatgggttgtaaaggccccaaaagtctcattggggtgcggaacgagaacaccttcttg
gatctgacggttcagcagattgagcacttaaacaaaacctacaacaccgacgttcctctt
gttcttatgaactccttcaacacggatgaagacacaaagaaaatcttgcagaaatacagt
cacacccgagtgaaaatatatacctttaatcaaagcaggtatcctagaattaataaggaa
actctgctgccaatagcgaaggatgtatcttactcaggagagaatacggagtgctggtat
cccccaggccatggagacatctatggcagtttctataactctggtctgctggataacctt
attgcagaggggaaggaatatatttttgtatccaatatcgataacttgggtgctacagtg
gacctttatattctgaatcatctaatgaacccacccaatggaaaacgctgtgaatttgtc
atggaagtcaccaacaaaaccagggctgatgtgaagggtgggacactcacgcaatatgaa
aacaaactgagactggtggagatagctcaggtcccaaaagcacacgttgatgaattcaag
tctgtctccaaattcaaaatattcaatacgaacaatctgtggattgccctgtctgcaatt
aaaaggctgcaagagaaaaatgctattgacatggagatcattgttaacccaaagactctg
gatggaggcttgaacgttatccagttggagactgcagttggtgctgctattaagagtttt
gagaactctctgggaataaatgtacctcgtagtcgttttctgcctgttaagaccacatct
gatctcctgcttgtgatgtctaatttgtatagtcttaatgctggatctctaacaatgagc
gagaagcgtgaatttccaaccgttcctcttgtcaaactgggaagttctttcacaaaggtt
caagattacctgcggaggtttgaaagtattccagatatgctggaactggatcatctcaca
gtttcaggcgatgttacatttgggaagaatgtttcattaaagggaacagttatcatcatt
gcaaatcatggcgacagaattgacatcccagctggagctgtactagagaacaaaatcgta
tcgggcaatcttcggatcttggaccactga

DBGET integrated database retrieval system