KEGG   Meleagris gallopavo (turkey): 100539842Help
Entry
100539842         CDS       T01523                                 

Definition
embryonic pepsinogen-like
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.4  chymosin
     100539842
Peptidases [BR:mgp01002]
 Aspartic Peptidases
  Family A1: pepsin family
   100539842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
28
AA seq 383 aa AA seqDB search
MQFLVLLCVVLALSDGITRLPLDRGKKLREILREKGLLHRFLQHHHYDIGTKFPHAFPDV
LTVVTEPLLNTLDMEYYGTISIGTPPQDFTVVFDTGSSNLWVPSVSCTSPACQSHQMFNP
SQSSTYKSTGQNLSIHYGTGDMEGTVGCDTVTVASLMDTNQLFGLSTSEPGQFFVYVKFD
GILGLGYPSLAADGITPVFDNMVNESLLEQNLFSVYLSRETMGSMVIFGGIDDSYFTGSI
NWIPVSYQGYWQISMDSIIVNKQEIACSSGCQAIIDTGTSLVAGPASDINDIQSAVGANQ
NSYGEYNVNCSHVLAMPDVVFVIGGIQYPVPALAYTEQNDQGTCMSSFQNSSADLWILGD
VFIRVYYSIFDRANNRVGLAKAI
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcctggtgctcctgtgtgtggttcttgctctctccgatggcatcaccaggctg
cccttggacaggggaaagaagctgagagagatcctccgggagaagggcttgctgcaccgc
ttcctccagcatcaccactacgacatcggcaccaaattcccgcatgcttttcctgatgtg
ctcactgtggtcaccgagcccctgctgaacaccctggacatggaatactatgggaccatc
tccattggcacccctccgcaggacttcactgtggtcttcgacactggctcctccaacctc
tgggttccctctgtctcctgcaccagcccagcttgccaaagccatcagatgtttaaccca
tcgcagtcctccacctacaaaagcacagggcagaacctgtccattcactatggcactggt
gacatggagggcaccgtgggctgcgacaccgtcactgttgcatcactgatggacaccaac
cagctctttggcttgagtacctccgagcctggccaattctttgtctatgtcaaatttgat
gggatcttgggcttgggctacccaagtttggctgctgatggaatcactccggtctttgat
aacatggtgaatgagagcttgctggagcagaacctcttctcagtctatctatcccgtgag
acaatggggagcatggtcatctttgggggaattgatgattcctatttcactggctccatc
aactggattcctgtttcttaccagggttactggcagatctccatggacagcatcatcgtg
aacaagcaggagattgcgtgcagcagtggctgccaagccatcattgacactggcacatcc
cttgtggccgggccggcctcagacattaatgacatccagagtgcagtcggggccaatcag
aactcatatggagagtacaacgtgaactgcagccatgtccttgccatgcctgatgttgtc
tttgtcatcggtggcattcagtatcccgtgcctgccttggcttacaccgagcagaatgac
caaggaacctgcatgagcagcttccagaatagctctgcagacctctggatcttgggagat
gtcttcatcagagtctactacagcatcttcgaccgggccaacaaccgtgtcggactggcc
aaggctatttag

DBGET integrated database retrieval system