KEGG   Meleagris gallopavo (turkey): 100539860Help
Entry
100539860         CDS       T01523                                 

Definition
uncharacterized LOC100539860
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mgp00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 881 aa AA seqDB search
MESGAGKHWTEEEVKALLSIWSEKSIRKQLHGTLRNKGIFIYIAKRLQELGVCRDWKQCR
AKYKNLKYEYRTVKYARNSGDATKTMKFFHDLDAILRCEPVAHLAAEGNSRCSTTARLNA
SPTADSSQGNPPPAVEASKTPAFIPTVANEGGKHWTVNEVRALIHIWSDKNIQQQLEGTV
RNKRIFEQVAARLQKFGIDRDWKQCRTKYKNLKHEYKSIKNGQDSGSTSRSMKFFNELDA
ILGHGTMEQASKSDNEESERPPEWTEAKSGKDSIEILEDEEDFSNSTLAALEATQIKKET
IDIDDDSISSTSEDRSCTLLAKQIVGTDNHIPLEEAQNHFKVITVNDTGAGKHWSDNEVR
ALINIWSDEKIQQMLEGATRNKEIFEEIARRLMKCGIDRDWKQCRTKYKNLKYEYRALQK
ENEHLGNPRRKMRFYDEVDCILRRQPLGPSGWGCESSSLLSELKLGKKVNEGKTKEVYEL
PDIPGCVLMQSKDQITAGNAARKDRMEGKAAISNTTTSCVFQLLQEAGIKTAFVRKQSDT
AFIAAHCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKIEMFYKDDANNDPQWSEEQ
LIEAKFSFAGLTIGKTEVDIMARSTQAIFEILEKSWQPQNCTLVDLKIEFGVNILTKEIV
LADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEALQMVKRNFEWVAERVELLLKTKS
QGRVVVLMGSTSDLGHCEKIKKACATFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTV
FVAVAGRSNGLGPVMSGNTAYPVVNCPPLSSDWGAQDVWSSLRLPSGLGCPTTLSPEGAA
QFAAQIFGLNNHLVWAKLRSNMLNTWISLKQADKKLRECTL
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atggagagtggagcggggaagcactggactgaggaggaggttaaagccttgctaagcatc
tggtcggagaagagcatcaggaagcagctccacggcaccctgaggaataaaggaatattc
atctacatcgccaaaaggctgcaggagttaggagtttgtagagattggaaacagtgccga
gcaaagtacaaaaacctgaagtatgaatacagaacagttaaatatgcccgcaactccggg
gatgccactaaaaccatgaagttttttcatgacctggatgccatactgcgatgtgaacct
gtcgcacacttggctgccgaggggaacagcaggtgctccaccaccgcacggctcaacgcc
agtcccaccgcagacagcagccaaggtaatccaccgccagctgtagaggcttccaaaaca
ccggctttcattccaacagtagcaaatgaaggaggaaaacattggactgttaatgaagtc
agagctctgatacacatatggtcagacaaaaatattcagcaacaactggaggggacagtg
agaaataaaagaatatttgaacaggttgctgctagacttcaaaagttcggaattgacagg
gactggaagcagtgcaggacaaaatataaaaatctgaaacatgaatacaagagcataaaa
aatggccaagactcagggagtacaagtagaagcatgaaattttttaatgaactggatgcc
attctggggcatggtaccatggaacaagcaagtaaatcagataatgaggaaagtgagagg
cctccagaatggacagaagcaaaatcaggaaaggactccatagaaatacttgaagatgag
gaggacttcagcaattccactctggcagctctggaagctacacaaataaagaaggagaca
attgatatagatgatgattctataagctctacctcagaagacagatcatgtacgctgcta
gcaaaacagatagttgggacagataatcatatccccttggaagaagcacaaaatcacttt
aaagtgatcacagttaatgacactggagcaggaaaacactggagtgacaatgaagtcaga
gctctgataaacatatggtcagatgaaaagatacagcaaatgcttgaaggggcaacaaga
aataaagaaatatttgaggaaattgccagaaggttaatgaaatgtggaatagacagagac
tggaaacaatgtcgcacgaagtacaagaacctaaaatatgaatatcgtgcactgcagaaa
gaaaatgaacatcttggtaatcccaggagaaaaatgagattttacgatgaagttgactgt
atcttaagaagacagcctctaggtccatcaggctggggatgtgaaagttcaagcctcctg
tcagaactgaaacttggtaaaaaagttaatgaaggtaaaacgaaagaagtgtatgagctg
ccggatatcccgggatgcgttctgatgcagtccaaggaccaaataacggcagggaatgcc
gccaggaaggaccggatggaggggaaggctgccatctccaacaccaccaccagctgcgtg
ttccagctgctgcaggaagcaggaatcaaaacagcttttgtcaggaagcagagtgacaca
gctttcatagcagctcactgtgaaatgatcccaattgaatgggtctgcagaagaattgct
actggctctttcctcaaaagaaaccctggagtcaaagaaggctataagttttacccgcct
aaaattgagatgttttacaaggatgatgctaataatgatccacagtggtctgaggagcag
ctaattgaagcaaaattctcttttgctggacttactattggcaagactgaagtggatatt
atggctcgttctactcaagctatttttgagatcctggagaaatcatggcagccccaaaac
tgcactctggtggacctgaagattgaatttggtgttaatattttgaccaaagaaattgtt
cttgctgatgttattgataatgattcatggagactgtggccatcgggagatagaagccag
cagaaggacaaacagtcctatcgagacctgaaggaagtgactcctgaagcactgcagatg
gttaagagaaactttgaatgggttgcagaaagagtagagttgcttctgaaaacaaagagc
caaggtagagttgtggtattgatgggctctacttctgaccttggccactgtgagaaaata
aagaaggcatgtgcaacctttggaattccttgtgaattaagagtaacctctgcacacaaa
gggccagatgaaactctgaggatcaaagcagaatatgaaggagatggaatcccaactgtg
ttcgttgcagtagctggcagaagcaatggtttaggaccagtaatgtctggtaacactgct
taccctgttgtcaactgtccccccctctcatctgattggggtgctcaggatgtgtggtct
tctctcagactgcccagtggtcttggctgccctactactttgtcacctgaaggagctgct
cagtttgctgcccagatatttgggttaaacaaccacttggtatgggccaaactgcgatca
aacatgttaaatacatggatctccttgaaacaggctgacaaaaaattgcgggagtgcacc
ttgtaa

DBGET integrated database retrieval system