KEGG   Meleagris gallopavo (turkey): 100539948Help
Entry
100539948         CDS       T01523                                 

Definition
histone deacetylase 10-like
Orthology
K18671  
histone deacetylase 10 [EC:3.5.1.98]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100539948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 557 aa AA seqDB search
MASGTALIYDEAMTRHKLLWNDPICDIEVPERLSASYEQLQCYHLVERCIPVPAREGSEE
EILLVHSSEHLEAAKSTQAMNEEELKRISGNYDSFFFHPNTYHCARLAVGAALQLVDSVM
SGKVCNGMALVRPPGHHSQRNAANGFCLFNNVAIAAEYAKLKYGLQRILIVDWDVHHGQG
TQYIFEEDPSVLYFSWHRYEHQEFWPSLKESDYDAVGLGKGKGFNINLPWNKVGMGNSDY
LAAFFHVLLPMAFEFDPELVLVSSGYDSGIGDPEGQMNATPEVFAHLTHFLMQLAHGKLC
VILEGGYHLRSLSESVCMTVRTLLRDPLPQVTGEMAPCLSAIESIQNVRAAHKPYWKWLT
YEVTAHKASLSNIRMNQIFILPVAVDIRLYQAPVCSGIAESPAASASVAVALRHSLHFGF
QRKILIIHVCKKEQTGKSSSKHYVVLNWKEDADGNDFFSAVLGFILPVAYSYQPNLIIIA
VGANRSLGISGISLIIGLLQGLAESRILAVIEIECWVLRYGCNSLGQSGWKGVGRCSAEH
EPALCPVGQQGRWCPAL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggaacagccctgatttacgatgaggcaatgaccaggcataagctgctttgg
aacgatcctatttgtgatattgaagtgccagaaagactgtcagcctcctatgagcagctt
cagtgttaccatcttgtggaaagatgcatccctgtgcctgctagagaaggaagcgaggag
gaaatccttttagttcacagttcagaacacttggaggctgcaaaaagcacacaggcaatg
aatgaagaggaactgaaaagaatctctggaaattatgattcttttttctttcatccgaac
acttaccactgtgccagactagctgtaggagcagctttgcagctagtggactctgtgatg
tcaggaaaagtgtgcaatggaatggcattagtaagacctccaggtcaccacagtcagaga
aatgcagctaatgggttctgcttgttcaacaacgttgctattgcagcagaatatgcaaaa
ctcaaatatggtcttcagagaatcctaattgttgactgggatgtgcaccatgggcaagga
actcagtatatatttgaagaagatccaagtgttttgtatttttcctggcatcgctatgaa
catcaggaattctggccatcgctcaaagaatctgattatgatgctgtgggtttgggaaaa
ggaaaaggttttaatataaatttaccttggaataaggttgggatgggaaattcagattat
cttgctgcattttttcatgtgttacttccaatggcttttgagtttgatcctgaactggtt
cttgtctcctctggatatgattcaggaattggagacccagagggtcagatgaatgccact
cctgaagtctttgcccaccttacccatttcctgatgcagttagctcatgggaagctgtgt
gtcatcctggagggtgggtaccatttgaggtccttgtctgaatccgtctgcatgaccgta
agaactttgctaagagatcctctgcctcaggtaactggagaaatggcaccttgcctaagc
gctattgagtctatccaaaatgtgagagcagcacataaaccctactggaaatggttgacg
tatgaagtcacagctcataaggcatcactctcaaacataaggatgaaccagatattcatt
cttccagttgctgtggacataagactgtatcaagcaccggtatgcagtggaattgcagaa
tcacctgcagcttctgcttctgttgctgttgcactgagacattctcttcattttgggttt
caaagaaaaatactcatcatacatgtttgcaagaaagaacagactggaaagagcagctct
aaacactatgttgtactaaactggaaagaggatgctgatgggaatgacttcttttctgct
gtgcttggattcattcttcctgtagcatatagttaccaacccaacttgataataatagct
gttggagcaaacaggagccttggaataagtgggatttctcttattattggtttgctacaa
ggactagcagaatctcgaattcttgcagtgattgagatcgagtgctgggtcctgcgctat
ggctgcaacagcttggggcagagcggctggaaaggtgttggtcgatgctcggctgaacat
gagccagcactgtgcccagttggccagcagggccggtggtgtcctgccttgtag

DBGET integrated database retrieval system