KEGG   Meleagris gallopavo (turkey): 100540062Help
Entry
100540062         CDS       T01523                                 

Gene name
PDIA4
Definition
(RefSeq) protein disulfide isomerase family A, member 4
  KO
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100540062 (PDIA4)
Enzymes [BR:mgp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100540062 (PDIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 627 aa AA seqDB search
MAQLAVLVAQEDGGESVIQEVDDDDEEDDDDDDDDDDEVKEENGVLVLNDENFDSFTADK
DTVLLEFYAPWCGHCKQFAPEYEKIAKTLKENDPPIPVAKIDATAATALASRFDVSGYPT
IKILKKGQPVDYDGSRTEDAIVAKVKEISDPNWTPPPEATLVLTQDNFDDVVKDADIILV
EFYAPWCGHCKRLAPEYEKAAQELSKRTPPIPLAKVDATAETELAKKFDVTGYPTLKIFR
KGKPYDYSGPREKYGIVDYMIEQAGPPSKQIQATKQVQEFLKDGDDVIIIGVFSGETDEA
YQLYQEAANSLREDYKFHHTFSNEIAKLLKVSPGKLVVMQPEKFQSKHESKMYVLDLKQY
STDESEIKEHVVKHALPLVGHRKPSNDAKRYAKRPLVVVYYTVDFSFDYRVATQYWRSKV
LEVAKDFPEYVFAVSDEEDYSSEIKDLGLLESGEDVNVAILDEGGKKYAMEPEEFDSDAL
RQFVLAFKKGKLKPIVKSQPVPKNNKGPVKVVVGKTFDTIVMDPKSDVLIEFYAPWCGHC
KKLEPVYTELGKKYKNEKNLVIAKMDATANDVTNDHYKVEGFPTIYFAPRDKKNNPIKFE
GGDRDLEHLSKFIEEHATKLSRTKEEL
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagctggccgtgctggtggcgcaggaggacggcggagaatctgttatacaagaa
gttgatgatgatgatgaagaagatgatgatgatgatgatgatgatgatgatgaagttaaa
gaagaaaatggtgtgttagttttgaatgatgaaaactttgacagctttactgcagacaag
gacactgtgcttctggaattctatgcaccatggtgtgggcattgcaagcagtttgctcct
gagtatgaaaagatagccaaaaccctgaaggaaaatgaccctcctattccagttgccaaa
attgatgctactgcagccactgcgctagcaagtcgttttgatgtcagtggttacccaacc
attaaaatcctgaaaaaaggccagcctgttgactacgatggttctcgaacagaagatgca
attgtagccaaagtcaaggagatttctgaccccaattggacccctccaccagaagctact
cttgtattgacccaggataattttgacgatgttgtgaaagatgctgacataattctggtg
gaattctatgctccatggtgtggacactgcaaaaggcttgctccagaatatgagaaggcc
gcccaagagctcagcaagcgcacacctcccattcctctggctaaagtcgatgccacggct
gaaactgagcttgcaaagaagtttgatgttactggctatccaacgctgaaaatctttcgc
aaaggcaaaccttatgactacagtggtccgcgagagaaatatggtattgttgactacatg
attgaacaggctggtcctccatctaagcagattcaggctacgaagcaggtacaggaattt
ctgaaggatggagatgatgtcattatcattggtgtttttagtggagaaactgatgaagcc
tatcagctctatcaggaagcagctaacagtttaagagaagattacaagttccatcacacc
ttcagcaacgagattgcaaaactattgaaagtatctcctggaaaactggttgtcatgcag
ccggaaaaatttcaatcaaagcatgaatccaagatgtatgttttggatcttaaacagtat
tctacagatgaatcagagatcaaagagcacgtagtgaaacatgctttgcctctagttggt
catcgcaagccttccaatgatgctaaaagatatgctaagcgccctctagtggttgtctat
tacactgttgactttagttttgactatcgtgttgctacccagtactggagaagcaaagtc
ctagaagtagccaaggacttccctgaatatgtgtttgctgtttctgatgaggaagattat
tcttctgaaataaaagatctaggtctgcttgagagtggagaggatgtaaatgttgccatt
ctggatgaaggtggcaagaaatatgccatggagccagaagagtttgactctgatgccctc
aggcagtttgtgctggcattcaaaaaaggaaaactgaagcctattgtgaagtcacagcca
gtgccaaaaaataacaaagggcctgtgaaagtggtagtgggtaaaacttttgataccata
gtaatggatccaaagagtgatgttctcatagagttctatgccccgtggtgtggacactgc
aagaaactagaaccggtgtatactgagctaggcaaaaaatacaagaatgagaaaaatcta
gtcatagccaagatggatgctactgccaacgatgtgacaaatgatcactacaaagtggaa
ggattccccaccatctactttgctccaagggacaagaagaacaatcccattaaatttgaa
ggcggtgacagagatctagagcatttgagtaaatttatagaggagcatgctacaaaactc
tctagaacaaaagaagagctttag

DBGET integrated database retrieval system