KEGG   Meleagris gallopavo (turkey): 100540149Help
Entry
100540149         CDS       T01523                                 

Gene name
PPT1
Definition
(RefSeq) palmitoyl-protein thioesterase 1
  KO
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100540149 (PPT1)
  Lipid metabolism
   00062 Fatty acid elongation
    100540149 (PPT1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100540149 (PPT1)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100540149 (PPT1)
Lipid biosynthesis proteins [BR:mgp01004]
 Fatty acid synthase
  Component type
   100540149 (PPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
25
AA seq 302 aa AA seqDB search
MALSASFADLKLPGGWRGEGGGRSLTLPRAPYPPPPSGDSCCNPLSMGYVRDLVQRRIPG
VYVLSLRVGSSLVQDVENSFFMNVNDQVREVCSQLAKDPHLKGGYNAMGFSQGGQFLRAV
AQRCPSPPMFNLISVGGQHQGVYGFPRCPGESSQICDWIRKMLDLGAYTQAVQEHLVQAQ
YWHDPLKEEDYRKKSIFLADINQERSINETYKKNLMALKKFVMVKFLNDTMVDPPISEWF
GFYKSGQAKDTIPLKETLLYKEDRLGLQQMDKAGKLVFLGVEGDHLHFTEEWFYTHILPF
LQ
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcagtgccagctttgcagacctgaaactgcctggcggatggcgaggtgaggga
ggcggccgcagcctgacgctgccccgcgccccttacccccctcctccttcaggagacagc
tgctgcaatccgctcagcatgggctacgtccgggacttggtgcagcgcaggatcccgggc
gtctacgttctgtccctgcgcgtcggcagctccctggtgcaggatgtggagaacagcttc
ttcatgaatgtcaatgaccaagtgagagaggtgtgcagccaactcgcaaaggaccctcac
ctgaaaggaggatacaacgcaatgggcttctcccaaggaggccagttcctgagggcggtg
gcccagaggtgcccttctcctcccatgttcaatctgatctccgttggggggcagcaccaa
ggagtgtatggctttccacgctgtcctggtgagagctcccagatctgtgactggatccga
aagatgctggatctgggtgcctacacacaagctgttcaagagcacttggtacaagcacag
tattggcatgatcctctgaaggaggaggactacaggaaaaagagcatctttttggctgac
ataaatcaggagaggagcatcaatgagacgtacaagaaaaacctgatggctttgaaaaag
tttgtgatggtgaaatttctcaatgacaccatggttgatcctccgatctctgagtggttt
gggttttacaaaagcggccaagccaaggacaccattcctctgaaggagaccttgctgtac
aaagaggatcgcctggggctgcagcagatggacaaagcaggaaagctggtgttcctgggg
gtggaaggggatcacctgcacttcacagaagagtggttttacacccatatcctcccattc
cttcagtga

DBGET integrated database retrieval system