KEGG   Meleagris gallopavo (turkey): 100540174Help
Entry
100540174         CDS       T01523                                 

Gene name
PLCE1
Definition
phospholipase C, epsilon 1
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mgp00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mgp04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:mgp04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 1899 aa AA seqDB search
ILNTVREEGAEDVFEFFPHLLRKLPALHTACICKGDDLCVKPCATGACSQYRATLQRTAL
SNYITGALLEATTSLGARSGLLNIFGGSAGRTMLKERQACTSMAGSSVLPSNVAGISKEL
IDLQHLIQFPEEVASILTEQEQELYRKVLPIDYLCFLTRDLGNAECQSKLPCIQASISAT
ILSTPNGEHNAVEDLVTRFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYN
AVMEFLAGLRSRKVLKMWQFMDQSDIETMRSLKDAMAQHESSSEYRKVVNRALNIPGCKV
VPFCGVFLKELCEILDGASSLIRLCPQYNSQDETLEFVSDYSGQDNFLQRVGQDGLNNPE
KESTANSMFQTIRSCNRSLESEEGEDNLSEESNSRKNSLKDRNRYQFIIGDLSDSESDIF
EQLKDWDTSSTEEQQKAFCHGIELIPWYVLSIRADVHQFMLQGATVIHYDQETHLSARCF
LQLQPDNSTLTWTKPTTVCPANAKAKLSVLGNAAELGKYQFLGSTGLNGLVEGFLDLFSA
KAVYMGHSGIDMHTVCVQNKLCNMSLEENGITLLYGLQTTDNKLLHFVAPKYTAKMLYDG
LLELTKAVRKMRRFPDQRLQWLRKQYVSLYQEDGRFEGPTLAQAVELFGGRRWSTRNTST
GTLTKSTEKPSVQRNNTLGISAAKKKKKVLMRGESGEATDDEMATRKAKSCKEYRNRSGS
DPQDIDEQEESDQNIISNASPSNTLSSRRAHSLTASGPPHLGAATSSPARPVSSPVMSSS
KSQSSTWSSSSWHGRVKGGMKGFQNFMVSDSNMTFVEFVELFKSFSVRSRKDLKDLFDVY
AVPCNRSGLEPTPLYTNLKIDENSIGFQPDLDLLTRNVSDLGLFIKSRQQLSDNQRQISD
AIAAASIVTNGTGVESTSLGVFGVGIQQLNDFLVNCQGEHCTYDEILSIIQKFEPSVNMC
QQGLLSFEGFARFLMDKDNFASKNDESQENAEDLQFPLSYYYIESSHNTYLTGHQLKGES
SVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKISFKEVVEAIDRNAFITSDMP
IIISIENHCSLPQQRKMAEIFKNVFGDKLVTKFLFESDFSDDPMLPSPGQLKRKILLKNK
KLKAHQTPVDILKQKAHQLAHMQAQASNGASNPTPTNEEEEDEEDEYDYDYESLSDDNIL
DDRPENKLSSDKLQFEYNEETAKRIKKADCATYSNKGKVYDMELGEEFYLPQNKKESRQI
APELSDLVIYCQAVKFPGLSTLNPSGSSRGKERKSRKSIFGNNPGRLSPGESATLAKASG
KGPFDVMRQTWEDPSSPFNSPASLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLIQHTT
CQLLRTYPAATRIDSSNPHPLIFWLHGVQLVALNYQTDDLPLQLNAAMFEANGGCGYVLK
PPVLWDKNCSMYQQFCPLERDLDNKEPAIYSLTIVSGQNVCPSNSTGSPCIEIDVLGMPL
DSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAVVENNSSAITAQRIIPLKALKR
GYRHVQLHNLHNEALEISSLFINSRRMEESPSGNTVPASVLFSSGERKASVPYKVTIHGI
PGPEPFTVFNISGGTTAAQLLHQLLETTKSTESCAADYFLMEEKSFLSKEKSECRKPPFQ
RVIGPEEGLVQLLNSWFPEEGYVGRIIFKTREENLNERNVFQEAKEDAAITSEDDSFFVQ
VHDVSPEQPRTVIKAPRFSTAQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVTKEPTNK
KSSTSKPSQRILSDQECVFQAQSKWKGAGKFILKLKEQVQAARDDKRKGISFTSELKKLT
KSSKQYRGFTSPPLQVLPDSPQNKDDRPTCSLTFSDVME
NT seq 5700 nt NT seq  +upstreamnt  +downstreamnt
attctcaataccgtgagggaagaaggagcagaagacgtctttgaattctttcctcatctt
ttgagaaaactcccagccttacatacagcctgtatatgcaaaggtgatgatttatgtgta
aaaccatgtgcaacaggtgcttgctctcagtaccgtgccactttacagaggactgcgctc
tctaactatataactggtgctttactagaagcaactacatcattaggagcaagaagtggt
cttctaaatatcttcggaggatcagctggaagaacaatgcttaaagaacgtcaagcgtgt
acatctatggctggctccagtgtccttccctccaacgtggctggtatcagcaaggagctc
attgacctgcagcacctcattcagttcccagaggaggttgccagcattctcactgaacag
gagcaggagctctaccggaaggtcttacccattgactacctctgcttcttaaccagggat
ttgggtaatgctgagtgtcaaagcaagcttccttgtattcaagcttccatatctgctact
attctttctaccccaaatggtgaacataatgctgtagaagatcttgtgacaagatttaat
gaggtgagctcgtgggttacctggctgatcctgactgcaggttctatggaggagaaacga
gaagtcttctcatatttagtacatgtggcaaaatgctgctggaacatgggcaactacaat
gctgtaatggaatttttggcaggactaaggtcaagaaaagttttaaaaatgtggcaattt
atggaccagtctgacattgaaaccatgcgaagtctgaaagatgctatggcacaacatgag
tcctcatccgagtacaggaaagtggtcaaccgggcactcaatattccaggctgcaaagta
gttcctttctgtggtgtatttttaaaagagctttgtgaaattttggatggagcatcaagc
ctcatcagactctgcccacagtataattcccaggatgagacattagagtttgtttcagat
tacagtggacaagataatttcttgcaacgggtaggccaagatggtttaaataatccagaa
aaagaatccacagcaaacagtatgtttcaaactattcggagctgtaatcgcagtttggaa
tctgaagagggggaagataatctcagtgaagaaagcaattcgagaaaaaactccttgaag
gacagaaaccgttaccaatttataattggagatctttcagattcagaaagtgatatattt
gagcagttgaaggactgggacacaagttcaacagaagagcaacaaaaggctttctgccac
ggcatagaactcattccctggtatgtgttgtccatcagagctgatgtccaccagttcatg
ctgcaaggtgcaactgtcatccattatgaccaggagacacatctttcagcacgttgcttt
cttcagcttcagcctgacaatagtactttgacgtggacaaaacccacaacagtttgccca
gcaaatgcaaaagcaaagctgagtgtcctgggtaatgctgctgaacttggtaaataccaa
ttccttggcagtaccggactaaatggactggtggaaggttttctggatttgttttcagcc
aaggctgtgtatatgggacattctggcattgatatgcacactgtgtgtgttcaaaataaa
ctttgtaatatgtccctcgaagaaaatggtataacactactttatggacttcagactact
gataataagttgctgcactttgttgctccaaaatatactgccaaaatgctctatgatgga
ctgctggaattgacgaaagctgtaagaaaaatgaggagattccctgatcagagattacag
tggctacggaaacagtatgtcagcctgtaccaggaggatggaaggtttgaaggcccaacc
ttggctcaggctgtcgaactgtttggaggcagacgatggagcacaaggaacacaagcaca
ggaactctgaccaaaagcactgagaaacctagtgtgcagagaaacaacactctgggaata
agtgcagctaagaaaaagaagaaagtacttatgaggggtgaaagtggagaggccactgat
gatgaaatggcaactcggaaggcaaaaagctgcaaggaatatcgaaacaggagtggttca
gatcctcaagatattgatgaacaagaagaatcagatcaaaatattattagtaatgcttct
ccatccaacaccctgtcatcaagaagagctcactctctgacagcatctggacctcctcat
ttaggagctgccacgtcctcaccagccagaccagtgtcctctcctgtaatgtcttcaagc
aagagtcagtcgagcacgtggagcagcagtagctggcacggccgtgttaaaggaggaatg
aaggggttccagaacttcatggtttctgatagtaacatgacttttgtggaatttgtggag
ctcttcaaatctttcagtgtccgtagccgcaaagaccttaaagacctttttgatgtctat
gctgtgccttgcaatcgatccggtctagagcctactccactttatactaatttgaagatt
gatgaaaacagcattggattccaacccgatttagatttgttgactaggaatgtttcagac
cttggtttgttcattaagagtaggcagcagctatcagataaccagaggcaaatatctgat
gctattgctgctgccagcattgtaactaatggtactggagtggaaagcacatcactgggg
gtatttggtgtgggcatccagcagctgaacgacttccttgtgaactgtcaaggagagcac
tgcacctatgatgaaatcctcagcattatccagaaatttgaacccagtgtcaatatgtgc
cagcaggggctactatctttcgaaggatttgcaaggtttttgatggataaagacaacttt
gcctccaaaaatgatgagtcacaagagaatgctgaggacttgcagtttccactgtcgtat
tactatattgaatcttcccacaatacctaccttactggccatcagcttaaaggggaatcc
tcggtggagctctacagccaggttctcttacaaggctgtagaagtgttgaattagactgc
tgggatggtgatgatgggatgcctatcatttaccatgggcacactcttactactaagatc
tcttttaaggaggtagttgaagccattgatcgcaatgcatttatcacctctgacatgcca
attatcatatccatagaaaaccactgttccttacctcagcagcgcaagatggctgaaatt
ttcaagaatgtatttggagataagctggtgaccaagtttttatttgagagtgacttttct
gacgatcccatgcttccttcacctggccaactgaaaagaaaaatcctgcttaaaaataag
aagctcaaagcccatcaaacaccagtggatatattgaaacagaaggctcaccagctggcg
catatgcaagcacaggctagcaatggtgctagcaaccccacacctaccaatgaagaggaa
gaagatgaagaggatgagtatgactatgactatgaatctctctctgatgataacattctt
gacgaccgacctgagaataaattatcaagtgataagctgcagtttgaatataatgaagag
actgccaaaagaataaagaaggctgattgtgctacttacagtaataaaggaaaggtttac
gacatggaactgggggaagaattctatcttccacaaaacaagaaggaaagccgacagata
gccccagagctatcagatcttgtcatttactgtcaagctgtgaagttcccaggcttgtca
actctaaacccatctggctctagcagaggaaaagaaagaaaaagcaggaagtccattttt
ggcaacaatcctggtagactgagccctggggagtcagctactcttgccaaagcatctgga
aaaggtccttttgatgtgatgcggcagacgtgggaagacccttcctctccttttaactct
ccagcttctctcagtgctatcataaggacgcccaagtgctatcacatttcctccctgaac
gagaacgcggccaaacggctgtgccggcggtactcccagaagctgatccagcacaccacc
tgccagctcctgcggacgtaccctgctgccacgcgcatcgactcgtccaatccccatcca
ctcatcttctggctccatggcgtgcaactcgtggctcttaactaccagacagacgatctt
cccctgcaactcaatgcagcgatgtttgaggctaatggtggctgtggatatgttctgaaa
cctcctgttctatgggataagaattgttcaatgtaccagcaattttgtccactagaaaga
gatcttgataataaggagccagctatatattctttaacaatcgtgtctgggcagaacgtg
tgccccagcaacagtacaggaagtccctgcatcgaaatcgatgtgctcgggatgcccctg
gacagctgccatttccggaccaaacccattcatcgcaacacgctcaacccaatgtggaac
gagcagtttcttttccgggttcattttgaagatttggtctttcttcggtttgcagttgtt
gaaaataacagttcagctataacggctcagagaatcattccactgaaagctctgaaaaga
ggctacagacatgtccagctccataacctgcacaatgaggcactggaaatctctagtttg
ttcataaacagtcggaggatggaagaaagtccctctggaaacactgtgcctgcatctgta
ttgtttagttcaggcgaaagaaaagcctctgtgccttacaaagtgacaatccatggaatt
ccaggcccagagcccttcactgtttttaacatcagtggagggactacggctgcacagctt
ctccatcagctcttggagaccacaaaaagcactgagtcatgtgctgcagactactttctg
atggaagagaaaagttttttatctaaagaaaagagtgaatgcagaaaaccaccattccag
agggtaattggtcctgaagaagggcttgtgcagctcttgaacagttggttcccagaagaa
ggatatgttggaagaatcatctttaaaacccgagaggaaaatttaaatgagagaaacgtc
tttcaagaagcaaaggaagatgcagccatcacctcagaggatgatagtttcttcgttcag
gtacatgatgtctcccctgagcagccacgcactgtcatcaaggcaccgcgcttcagcacc
gcgcaggatgtcatacagcagactctttgcaaagccaagtactcctacagcattctgagc
aatccaaatccgagtgactatgttctcctggaagaggtgacaaaagagccaacaaacaag
aagtcctcaacatctaaaccgtctcagaggattctctctgatcaagagtgtgtgtttcag
gcccaaagcaagtggaagggagcaggaaaatttattcttaaactcaaagaacaggttcag
gcagcacgagatgacaaaagaaaaggcatttcctttaccagtgagctcaaaaagctgacc
aagtcaagtaagcagtaccggggcttcacttcaccacccctgcaagtcctgcctgacagc
ccacaaaataaggatgacaggcccacgtgcagcttgacttttagcgacgttatggaatag

DBGET integrated database retrieval system