KEGG   Meleagris gallopavo (turkey): 100540174Help
Entry
100540174         CDS       T01523                                 

Gene name
PLCE1
Definition
(RefSeq) phospholipase C epsilon 1
  KO
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100540174 (PLCE1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100540174 (PLCE1)
   04070 Phosphatidylinositol signaling system
    100540174 (PLCE1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100540174 (PLCE1)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100540174 (PLCE1)
Membrane trafficking [BR:mgp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100540174 (PLCE1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100540174 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
8
AA seq 2280 aa AA seqDB search
MTSEEMTASVLVSVVQGKVIPAQSAGDENTENALDTSVIKRHTASPGRQTTRAVSYLHRL
EEESLQGSVPKIFTLTNKEMTDDNINESFWERNNAISDSVKFLNINCNIVQKNYKSNIPC
GQLYKSCGSLAGGEACLETGIPVSLERAMLAEIQLKMNGPSLRSQTAVNKSDGNDTDEVA
FFHFHCASERNISKALCKLHNGFILNDCLQPVSVDNGSTTGSPACTCTLVELTNNCENEN
GQHLYDDTLRDKYFCLERAPRKVKVCSGHSFFGNNFTGRMPSKPFLSHFEDCNDNCEEEM
EEDFFRNKKERSTLLIRRFCKNDKEVKKSVYTGTRAIVRTLPSGHIGTAAWNYVEQRKNN
SGLKCSRITTEQLTIIQSLIKWEFNSFLETSLWYEILNTVREEGAEDVFEFFPHLLRKLP
ALHTACICKGDDLCVKPCATGACSQYRATLQRTALSNYITGALLEATTSLGARSGLLNIF
GGSAGRTMLKERQACTSMAGSSVLPSNVAGISKELIDLQHLIQFPEEVASILTEQEQELY
RKVLPIDYLCFLTRDLGNAECQSKLPCIQASISATILSTPNGEHNAVEDLVTRFNEVSSW
VTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQSD
IETMRSLKDAMAQHESSSEYRKVVNRALNIPGCKVVPFCGVFLKELCEILDGASSLIRLC
PQYNSQDETLEFVSDYSGQDNFLQRVGQDGLNNPEKESTANSMFQTIRSCNRSLESEEGE
DNLSEESNSRKNSLKDRNRYQFIIGDLSDSESDIFEQLKDWDTSSTEEQQKAFCHGIELI
PWYVLSIRADVHQFMLQGATVIHYDQETHLSARCFLQLQPDNSTLTWTKPTTVCPANAKA
KLSVLGNAAELGKYQFLGSTGLNGLVEGFLDLFSAKAVYMGHSGIDMHTVCVQNKLCNMS
LEENGITLLYGLQTTDNKLLHFVAPKYTAKMLYDGLLELTKAVRKMRRFPDQRLQWLRKQ
YVSLYQEDGRFEGPTLAQAVELFGGRRWSTRNTSTGTLTKSTEKPSVQRNNTLGISAAKK
KKKVLMRGESGEATDDEMATRKAKSCKEYRNRSGSDPQDIDEQEESDQNIISNASPSNTL
SSRRAHSLTASGPPHLGAATSSPARPVSSPVMSSSKSQSSTWSSSSWHGRVKGGMKGFQN
FMVSDSNMTFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGLEPTPLYTNLKIDENSI
GFQPDLDLLTRNVSDLGLFIKSRQQLSDNQRQISDAIAAASIVTNGTGVESTSLGVFGVG
IQQLNDFLVNCQGEHCTYDEILSIIQKFEPSVNMCQQGLLSFEGFARFLMDKDNFASKND
ESQENAEDLQFPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDD
GMPIIYHGHTLTTKISFKEVVEAIDRNAFITSDMPIIISIENHCSLPQQRKMAEIFKNVF
GDKLVTKFLFESDFSDDPMLPSPGQLKRKILLKNKKLKAHQTPVDILKQKAHQLAHMQAQ
ASNGASNPTPTNEEEEDEEDEYDYDYESLSDDNILDDRPENKLSSDKLQFEYNEETAKRI
KKADCATYSNKGKVYDMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNPS
GSSRGKERKSRKSIFGNNPGRLSPGESATLAKASGKGPFDVMRQTWEDPSSPFNSPASLS
AIIRTPKCYHISSLNENAAKRLCRRYSQKLIQHTTCQLLRTYPAATRIDSSNPHPLIFWL
HGVQLVALNYQTDDLPLQLNAAMFEANGGCGYVLKPPVLWDKNCSMYQQFCPLERDLDNK
EPAIYSLTIVSGQNVCPSNSTGSPCIEIDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLF
RVHFEDLVFLRFAVVENNSSAITAQRIIPLKALKRGYRHVQLHNLHNEALEISSLFINSR
RMEESPSGNTVPASVLFSSGERKASVPYKVTIHGIPGPEPFTVFNISGGTTAAQLLHQLL
ETTKSTESCAADYFLMEEKSFLSKEKSECRKPPFQRVIGPEEGLVQLLNSWFPEEGYVGR
IIFKTREENLNERNVFQEAKEDAAITSEDPRTVIKAPRFSTAQDVIQQTLCKAKYSYSIL
SNPNPSDYVLLEEVTKEPTNKKSSTSKPSQRILSDQECVFQAQSKWKGAGKFILKLKEQV
QAARDDKRKGISFTSELKKLTKSSKQYRGFTSPPLQVLPDSPQNKDDRPTCSLTFSDVME
NT seq 6843 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgaagagatgacagcttctgttctggtctctgtcgtgcagggtaaagtgata
cctgctcagtcagctggagatgaaaatactgaaaatgctttggacaccagtgttataaaa
agacacactgccagtccaggaaggcaaaccacacgcgctgtctcatatttacacaggctg
gaagaagaaagtcttcagggctcagtgcccaaaatattcactttgacaaataaagaaatg
accgatgacaatattaatgaaagcttctgggagaggaacaacgccatctctgattcagtg
aaatttcttaacattaactgtaacattgtgcagaaaaactacaagagcaatatcccatgt
ggtcagttgtataaatcttgtggctctttagcagggggagaggcgtgcctagaaactgga
attcctgtttcactggaaagagctatgcttgctgaaattcagttgaaaatgaatggacct
tcgctaagaagccagacagcagtaaataagagtgatggcaatgatactgatgaagtagcc
ttttttcactttcattgtgctagtgaaaggaatatatcaaaagctttgtgcaaattgcac
aatggcttcatattgaatgactgcttacagccagtaagtgttgacaatggtagcactact
ggttccccggcatgcacttgcacgttagtggagttgacaaataattgtgagaatgaaaat
gggcaacacttgtatgacgacactttaagagataagtacttctgtctggaaagagcacca
cgaaaggttaaagtgtgctcgggtcacagcttttttggaaacaactttactggaaggatg
ccctcaaagccctttctgagccattttgaagactgcaatgataactgtgaagaagagatg
gaggaggatttttttagaaacaaaaaggaacgttccacattattaataagacgtttctgt
aaaaatgataaggaggttaaaaaatcagtttatactggaacgagagcgattgttagaact
ttaccttcagggcacattggaactgctgcttggaattacgttgagcagaggaaaaacaac
agtggcttgaagtgttctaggattacaacagaacagctaactataattcagagcttaata
aagtgggaatttaattcctttcttgagacctctttgtggtatgagattctcaataccgtg
agggaagaaggagcagaagacgtctttgaattctttcctcatcttttgagaaaactccca
gccttacatacagcctgtatatgcaaaggtgatgatttatgtgtaaaaccatgtgcaaca
ggtgcttgctctcagtaccgtgccactttacagaggactgcgctctctaactatataact
ggtgctttactagaagcaactacatcattaggagcaagaagtggtcttctaaatatcttc
ggaggatcagctggaagaacaatgcttaaagaacgtcaagcgtgtacatctatggctggc
tccagtgtccttccctccaacgtggctggtatcagcaaggagctcattgacctgcagcac
ctcattcagttcccagaggaggttgccagcattctcactgaacaggagcaggagctctac
cggaaggtcttacccattgactacctctgcttcttaaccagggatttgggtaatgctgag
tgtcaaagcaagcttccttgtattcaagcttccatatctgctactattctttctacccca
aatggtgaacataatgctgtagaagatcttgtgacaagatttaatgaggtgagctcgtgg
gttacctggctgatcctgactgcaggttctatggaggagaaacgagaagtcttctcatat
ttagtacatgtggcaaaatgctgctggaacatgggcaactacaatgctgtaatggaattt
ttggcaggactaaggtcaagaaaagttttaaaaatgtggcaatttatggaccagtctgac
attgaaaccatgcgaagtctgaaagatgctatggcacaacatgagtcctcatccgagtac
aggaaagtggtcaaccgggcactcaatattccaggctgcaaagtagttcctttctgtggt
gtatttttaaaagagctttgtgaaattttggatggagcatcaagcctcatcagactctgc
ccacagtataattcccaggatgagacattagagtttgtttcagattacagtggacaagat
aatttcttgcaacgggtaggccaagatggtttaaataatccagaaaaagaatccacagca
aacagtatgtttcaaactattcggagctgtaatcgcagtttggaatctgaagagggggaa
gataatctcagtgaagaaagcaattcgagaaaaaactccttgaaggacagaaaccgttac
caatttataattggagatctttcagattcagaaagtgatatatttgagcagttgaaggac
tgggacacaagttcaacagaagagcaacaaaaggctttctgccacggcatagaactcatt
ccctggtatgtgttgtccatcagagctgatgtccaccagttcatgctgcaaggtgcaact
gtcatccattatgaccaggagacacatctttcagcacgttgctttcttcagcttcagcct
gacaatagtactttgacgtggacaaaacccacaacagtttgcccagcaaatgcaaaagca
aagctgagtgtcctgggtaatgctgctgaacttggtaaataccaattccttggcagtacc
ggactaaatggactggtggaaggttttctggatttgttttcagccaaggctgtgtatatg
ggacattctggcattgatatgcacactgtgtgtgttcaaaataaactttgtaatatgtcc
ctcgaagaaaatggtataacactactttatggacttcagactactgataataagttgctg
cactttgttgctccaaaatatactgccaaaatgctctatgatggactgctggaattgacg
aaagctgtaagaaaaatgaggagattccctgatcagagattacagtggctacggaaacag
tatgtcagcctgtaccaggaggatggaaggtttgaaggcccaaccttggctcaggctgtc
gaactgtttggaggcagacgatggagcacaaggaacacaagcacaggaactctgaccaaa
agcactgagaaacctagtgtgcagagaaacaacactctgggaataagtgcagctaagaaa
aagaagaaagtacttatgaggggtgaaagtggagaggccactgatgatgaaatggcaact
cggaaggcaaaaagctgcaaggaatatcgaaacaggagtggttcagatcctcaagatatt
gatgaacaagaagaatcagatcaaaatattattagtaatgcttctccatccaacaccctg
tcatcaagaagagctcactctctgacagcatctggacctcctcatttaggagctgccacg
tcctcaccagccagaccagtgtcctctcctgtaatgtcttcaagcaagagtcagtcgagc
acgtggagcagcagtagctggcacggccgtgttaaaggaggaatgaaggggttccagaac
ttcatggtttctgatagtaacatgacttttgtggaatttgtggagctcttcaaatctttc
agtgtccgtagccgcaaagaccttaaagacctttttgatgtctatgctgtgccttgcaat
cgatccggtctagagcctactccactttatactaatttgaagattgatgaaaacagcatt
ggattccaacccgatttagatttgttgactaggaatgtttcagaccttggtttgttcatt
aagagtaggcagcagctatcagataaccagaggcaaatatctgatgctattgctgctgcc
agcattgtaactaatggtactggagtggaaagcacatcactgggggtatttggtgtgggc
atccagcagctgaacgacttccttgtgaactgtcaaggagagcactgcacctatgatgaa
atcctcagcattatccagaaatttgaacccagtgtcaatatgtgccagcaggggctacta
tctttcgaaggatttgcaaggtttttgatggataaagacaactttgcctccaaaaatgat
gagtcacaagagaatgctgaggacttgcagtttccactgtcgtattactatattgaatct
tcccacaatacctaccttactggccatcagcttaaaggggaatcctcggtggagctctac
agccaggttctcttacaaggctgtagaagtgttgaattagactgctgggatggtgatgat
gggatgcctatcatttaccatgggcacactcttactactaagatctcttttaaggaggta
gttgaagccattgatcgcaatgcatttatcacctctgacatgccaattatcatatccata
gaaaaccactgttccttacctcagcagcgcaagatggctgaaattttcaagaatgtattt
ggagataagctggtgaccaagtttttatttgagagtgacttttctgacgatcccatgctt
ccttcacctggccaactgaaaagaaaaatcctgcttaaaaataagaagctcaaagcccat
caaacaccagtggatatattgaaacagaaggctcaccagctggcgcatatgcaagcacag
gctagcaatggtgctagcaaccccacacctaccaatgaagaggaagaagatgaagaggat
gagtatgactatgactatgaatctctctctgatgataacattcttgacgaccgacctgag
aataaattatcaagtgataagctgcagtttgaatataatgaagagactgccaaaagaata
aagaaggctgattgtgctacttacagtaataaaggaaaggtttacgacatggaactgggg
gaagaattctatcttccacaaaacaagaaggaaagccgacagatagccccagagctatca
gatcttgtcatttactgtcaagctgtgaagttcccaggcttgtcaactctaaacccatct
ggctctagcagaggaaaagaaagaaaaagcaggaagtccatttttggcaacaatcctggt
agactgagccctggggagtcagctactcttgccaaagcatctggaaaaggtccttttgat
gtgatgcggcagacgtgggaagacccttcctctccttttaactctccagcttctctcagt
gctatcataaggacgcccaagtgctatcacatttcctccctgaacgagaacgcggccaaa
cggctgtgccggcggtactcccagaagctgatccagcacaccacctgccagctcctgcgg
acgtaccctgctgccacgcgcatcgactcgtccaatccccatccactcatcttctggctc
catggcgtgcaactcgtggctcttaactaccagacagacgatcttcccctgcaactcaat
gcagcgatgtttgaggctaatggtggctgtggatatgttctgaaacctcctgttctatgg
gataagaattgttcaatgtaccagcaattttgtccactagaaagagatcttgataataag
gagccagctatatattctttaacaatcgtgtctgggcagaacgtgtgccccagcaacagt
acaggaagtccctgcatcgaaatcgatgtgctcgggatgcccctggacagctgccatttc
cggaccaaacccattcatcgcaacacgctcaacccaatgtggaacgagcagtttcttttc
cgggttcattttgaagatttggtctttcttcggtttgcagttgttgaaaataacagttca
gctataacggctcagagaatcattccactgaaagctctgaaaagaggctacagacatgtc
cagctccataacctgcacaatgaggcactggaaatctctagtttgttcataaacagtcgg
aggatggaagaaagtccctctggaaacactgtgcctgcatctgtattgtttagttcaggc
gaaagaaaagcctctgtgccttacaaagtgacaatccatggaattccaggcccagagccc
ttcactgtttttaacatcagtggagggactacggctgcacagcttctccatcagctcttg
gagaccacaaaaagcactgagtcatgtgctgcagactactttctgatggaagagaaaagt
tttttatctaaagaaaagagtgaatgcagaaaaccaccattccagagggtaattggtcct
gaagaagggcttgtgcagctcttgaacagttggttcccagaagaaggatatgttggaaga
atcatctttaaaacccgagaggaaaatttaaatgagagaaacgtctttcaagaagcaaag
gaagatgcagccatcacctcagaggatccacgcactgtcatcaaggcaccgcgcttcagc
accgcgcaggatgtcatacagcagactctttgcaaagccaagtactcctacagcattctg
agcaatccaaatccgagtgactatgttctcctggaagaggtgacaaaagagccaacaaac
aagaagtcctcaacatctaaaccgtctcagaggattctctctgatcaagagtgtgtgttt
caggcccaaagcaagtggaagggagcaggaaaatttattcttaaactcaaagaacaggtt
caggcagcacgagatgacaaaagaaaaggcatttcctttaccagtgagctcaaaaagctg
accaagtcaagtaagcagtaccggggcttcacttcaccacccctgcaagtcctgcctgac
agcccacaaaataaggatgacaggcccacgtgcagcttgacttttagcgacgttatggaa
tag

DBGET integrated database retrieval system