KEGG   Meleagris gallopavo (turkey): 100540197Help
Entry
100540197         CDS       T01523                                 

Gene name
CLK2
Definition
(RefSeq) CDC-like kinase 2
  KO
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100540197 (CLK2)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100540197 (CLK2)
Spliceosome [BR:mgp03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100540197 (CLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
27
AA seq 502 aa AA seqDB search
MPHSRRFRSSERSSRGSFHERYRSRKHKRRRSRSSSSERERRHRREGSYHVRSRSYDDHS
ADRRAYDRRYCDSYRRNDYSRERGEPYYDPEYRHSYEYRRSRDRDGSYRSCKSSRRKHRR
RRRRSRSFSRSSSQRSRQSSRRAKSVEDDDEGHLIYRVGDWLQERYEILSTLGEGTFGRV
VQCMDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPENKNLCVRMFDWFDYHG
HMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQVCQAVKFLHDNKLTHTDLKPENIL
FVNSDYELTYNLEKKRDERSVKSTAIRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELG
WSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYHG
RLDWDENTSAGRYVRDNCKPLRRYLTSEAEDHHRLFDLIESMLEYEPSKRISLAEALKHP
FFDVLEMEPSTKMWDSSRDISR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcctcattccagaaggttccgctcgtcggagcgcagcagccggggcagcttccacgag
cgttacaggagccgcaaacacaagaggcggcggtcgagatccagcagcagcgaacgtgag
aggaggcaccgccgggagggcagctaccacgtccgctccaggagctacgacgaccactca
gcagacaggagggcctacgaccgccgttactgcgacagctaccgccgcaacgattacagc
cgggagcgaggagagccctactacgaccccgagtaccggcattcctacgagtaccggcgc
tcccgggaccgcgacggcagctaccggagctgcaaaagcagccggcgtaagcacaggcgg
aggcggcgccgcagccggtcctttagtcgttcctcatcgcagcggagtcgacagagcagc
agaagggccaagagtgtggaggacgacgacgaggggcatctgatctatcgcgtcggcgac
tggctacaagaaagatatgagattctcagcactttaggggaaggcacgttcggcagagtg
gtgcagtgcatggatcaccggaggggtggtgcacgtgttgctctcaaaatcattaaaaat
gtggagaagtacaaagaggctgccaggctggagatcaacgtgctggagaaaatcaacgag
aaggatcctgagaacaagaacctctgtgtcaggatgtttgactggtttgactaccacggc
cacatgtgcatctcctttgaactgctgggcctcagcacttttgatttcctgaaggacaac
aattatctgccttaccccatccaccaagtgcggcacatggccttccaggtgtgccaggct
gtgaaatttctgcatgacaacaaactcactcacaccgacctcaaacctgagaacatcctc
tttgtcaactctgactacgagctcacctataacctggaaaagaagcgggatgagcgcagt
gtgaagagcacagccatcagagtggtggattttggcagtgccacgtttgaccacgagcat
cacagcacaattgtgtctaccaggcactaccgggcccctgaggtcattctggagcttggc
tggagccaaccctgcgatgtctggagcatcggctgcatcatctttgagtattatgtgggt
ttcaccctgttccagacacacgacaaccgggagcacctggccatgatggagaggatcttg
gggccaattccttctcggatgatccggaagaccaggaagcagaagtatttctaccatggc
cgtttggactgggacgagaacacctctgctggccgttacgttagggacaactgcaagccg
ctgcggcgctacctgacctctgaggctgaggaccaccaccgccttttcgacctcattgag
agcatgctggaatacgagccgtccaaacgcatcagcctggctgaagccctcaagcaccca
ttttttgacgtgctggagatggagccgagcacaaagatgtgggactctagcagagacatc
agccggtga

DBGET integrated database retrieval system