KEGG   Meleagris gallopavo (turkey): 100540197Help
Entry
100540197         CDS       T01523                                 

Definition
dual specificity protein kinase CLK2-like
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100540197
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100540197
Spliceosome [BR:mgp03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100540197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
27
AA seq 605 aa AA seqDB search
MPSHHYDDHSADRRAYDRRYCDSYRRNDYSRERGEPYYDPEYRHSYEYRRSRDRDGSYRS
CKSSRRKHRRRRRRSRSFSRSSSKTRFLTSLLDLARGTVRFGEGFGCCPDAARLRRVGSS
AASGGRERLAGLARPPGALLQSNPSSFIPSELCFCLLVLVKGCEPRPSSLCVRFVRQAFG
CSRPRRAQAVCSRSLWPLSRACGRSSSSEQSPVSAQAPFGWAQCLWDATEGMQLVVCSAR
AEAASSSGSSRQRPRLSLLVCSAVHLPLLSEPSRVLCSVLELSVLSGPFSPGGARVALKI
IKNVEKYKEAARLEINVLEKINEKDPENKNLCVRMFDWFDYHGHMCISFELLGLSTFDFL
KDNNYLPYPIHQVRHMAFQVCQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRD
ERSVKSTAIRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEY
YVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYHGRLDWDENTSAGRYVRDN
CKPLRRYLTSEAEDHHRLFDLIESMLEYEPSKRISLAEALKHPFFDVLEMEPSTKMWDSS
RDISR
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgccaagccaccactacgacgaccactcagcagacaggagggcctacgaccgccgttac
tgcgacagctaccgccgcaacgattacagccgggagcgaggagagccctactacgacccc
gagtaccggcattcctacgagtaccggcgctcccgggaccgcgacggcagctaccggagc
tgcaaaagcagccggcgtaagcacaggcggaggcggcgccgcagccggtcctttagtcgt
tcctcatcgaaaactcgctttctaacctcgctcttggatttggctcgaggaacggttagg
tttggtgaggggtttggctgctgtcctgatgcggctcggttgcgccgtgtcggttcgagt
gctgcctcaggaggacgggagcgcctggcagggctggcacggccccctggggcgctgctg
cagtccaaccccagctcctttatcccctccgagctctgcttttgtctgctggtgctcgtt
aagggctgtgaaccccggccaagcagcctttgtgtgaggtttgtgcggcaggcgttcggc
tgttcccgaccccgcagagcccaggctgtgtgcagcaggtccctctggcccctgagccgg
gcctgcggcaggagctccagctctgagcaaagccccgtgtcagcgcaggctcctttcggg
tgggcccagtgcttgtgggatgccacagaggggatgcagcttgtggtctgctcagctcgg
gcagaggcagcgagcagctcaggctcttcccggcagcgtccccggctttctcttctcgtc
tgttctgctgttcacctcccgcttctgtcggagcccagccgtgttctctgctctgtgctg
gagctctcagtgttgtctggtccgttctcaccgggtggtgcacgtgttgctctcaaaatc
attaaaaatgtggagaagtacaaagaggctgccaggctggagatcaacgtgctggagaaa
atcaacgagaaggatcctgagaacaagaacctctgtgtcaggatgtttgactggtttgac
taccacggccacatgtgcatctcctttgaactgctgggcctcagcacttttgatttcctg
aaggacaacaattatctgccttaccccatccaccaagtgcggcacatggccttccaggtg
tgccaggctgtgaaatttctgcatgacaacaaactcactcacaccgacctcaaacctgag
aacatcctctttgtcaactctgactacgagctcacctataacctggaaaagaagcgggat
gagcgcagtgtgaagagcacagccatcagagtggtggattttggcagtgccacgtttgac
cacgagcatcacagcacaattgtgtctaccaggcactaccgggcccctgaggtcattctg
gagcttggctggagccaaccctgcgatgtctggagcatcggctgcatcatctttgagtat
tatgtgggtttcaccctgttccagacacacgacaaccgggagcacctggccatgatggag
aggatcttggggccaattccttctcggatgatccggaagaccaggaagcagaagtatttc
taccatggccgtttggactgggacgagaacacctctgctggccgttacgttagggacaac
tgcaagccgctgcggcgctacctgacctctgaggctgaggaccaccaccgccttttcgac
ctcattgagagcatgctggaatacgagccgtccaaacgcatcagcctggctgaagccctc
aagcacccattttttgacgtgctggagatggagccgagcacaaagatgtgggactctagc
agagacatcagccggtga

DBGET integrated database retrieval system