KEGG   Meleagris gallopavo (turkey): 100540230Help
Entry
100540230         CDS       T01523                                 

Gene name
SOS2
Definition
son of sevenless homolog 2 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mgp04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:mgp04012]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:mgp04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mgp04068]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mgp04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:mgp04510]
Cellular Processes; Cell communication; Gap junction [PATH:mgp04540]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:mgp04910]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:mgp04912]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:mgp04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 1330 aa AA seqDB search
MQPPPQPYEFFGEENGPKWRGLFVPALRKVQQQVHPNLSAKEDSLYYIEELILQLLNKLC
IAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPLLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHFEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRNEIAEERQYLRELNLIIKVFREAFLSNRKLFTPNDI
DVVFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPQFHEHFNNLMAKPAVALHFQSTAEGFKEAVRYVLPRLMLIPVYHCLHYFELLQQLQE
CSEDEEDRECLKQAITALLNLQCSMERIYSKHSPRRRPGEPVCRFYNRQIRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGTLTKIGAKHERHIFLFDGLMISCKTNHGQSRLPG
YSNAEYRLKEKIIMRKIQIIDKDDTSEYKHAFELVSKDENSILFAAKSAEEKSNWMAALI
SLQYRSTLDRMLDSVLLQEENEQPLRLPSPNVYRFVVEDSEDNIVFEDNLQSRNGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADRLA
IEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLETFISSVR
GKSMKKWVESIAKIIKRKKAQANGISHNITFESPPPPIEWHIWRVGHSEMLDLMTLHPIE
IARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETE
NFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAMNSVSVYRLDHTFEALQERKKRVLDE
AVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRQGKELINFSKRRK
VAEITGEIQQYQNQPYCLRIEPEIRKFFENLNPMGKIPEKEFTDYLFNKSLEIEPRNCKQ
PPRFPRKTTYPLKSPGIRPNAGRHGSTSGTLRSHPLPLEKEPSKISFSRITEAEHESAVS
APTSPNTPSTPPVSASSEFSVFLDIDLNSSYGSNSIFAPVSLPQSKTFFSSWGSFPKLSD
EPQNPPPLPPRKKMDQDVSNAKGSLKSDDDPPAIPPRQPPPPKIQPRAPAYSPFEQPLHS
PPPPPPRDPLPDTPPPVPHRPPEHFINCPLNLQPPPVGRMHRDPDWFREAGPGPSSPGTP
PSTPSPRVLRRCCVIGASHNSPGHLPAPPVPPRQNSSPQLPKLPPKTYKRELSHPPLHRL
SLLENAEAPQ
NT seq 3993 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgccgccgcagccctacgagttcttcggtgaggagaacggcccgaaatggcgg
gggctgttcgtgcccgccctgcgcaaggttcagcaacaggttcaccccaacctttcagca
aaggaagattccctctactacattgaggagttgatacttcagctgctaaacaagctatgc
atcgcccagccacgcacagtccaagacgtagaggagcgtgttcagaagacgtttcctcat
cccatagacaaatgggccattgctgatgcacagtctgccatagagaaacggaaaagaaga
aaccctctcctgctgcctgtggacaaaatacaccccttattaaaggaggtcctgggttat
aaagtagattaccatgtctctctgtatattgtggctgtcttagaatacatctcagctgat
attttaaagctggctggaaactacgttttcaatatacgacactttgagatctcccagcag
gacattaaagtatccatgtgtgctgataaggttttgatggatatgtttgatcaggatgac
attggcttggtttctctctgtgaagacgaaccttcttcttccggggaactcaattattat
gacctagtgagaaatgaaattgcagaagaaaggcaatatctccgggagctgaatctgata
ataaaagtatttcgggaagctttcctctctaacagaaagttgttcacacctaatgacatt
gatgtggtgttcagcaacatttcagatattcatgagttgacagtgaagcttttgggattg
attgaggatactgttgaaatgactgatgagagcagtcctcatcctctggctggcagctgc
tttgaggatcttgctgaggaacaagcctttgatccatatgaaaccttgtcccaggatatt
ctctctccacaatttcatgagcattttaataacttaatggcaaaacctgctgttgctctt
cacttccagtctactgctgaaggttttaaagaagctgtacgatatgtcctcccacggctc
atgcttatcccagtctatcattgtttgcactactttgagttactgcagcaactgcaggaa
tgcagtgaagatgaggaggatcgggagtgcttaaaacaagccattactgctcttctgaat
ctccagtgcagcatggagcgcatctacagcaaacactccccaagacgtcggcctggggag
ccagtttgtcgcttctataaccggcaaataagaagcaagcacttggccatcaagaaaatg
aacgaaatccagaaaaatattgatggctgggaaggcaaagatattgggcagtgctgtaat
gaattcataatggaaggcaccttgacaaaaataggagctaaacacgaacgacacatcttc
ctctttgatggcttaatgatcagctgtaaaactaaccatggccagtcacggctccccggt
tacagcaacgcggagtatagactgaaggaaaagataatcatgaggaaaatacagattatt
gataaagatgacacatctgaatataaacatgcttttgaactggtgtctaaagatgaaaac
agtatactctttgctgccaagtctgctgaagagaagagtaattggatggctgctctgatt
tccctccagtaccggagcactcttgataggatgctcgactcagtgctactgcaagaggaa
aatgaacagccactgaggttgcccagcccaaacgtgtaccgctttgtagtagaagattct
gaggataacattgtttttgaggacaacttgcaaagcaggaatgggattcccatcatcaaa
ggaggaacggttgtgaaattaattgagaggctaacgtaccatatgtatgcagatcccaat
tttgtacgtactttccttaccacgtaccgttccttttgcaagccccaggaactgctgagt
ttactgattgaaaggtttgaaatcccagagcctgagcctactgaagcagacaggctggca
atcgagaaaggggagcagcccatcagtgcagaccttaagcgatttcgcaaggaatacgtc
cagccagtgcaactcagaatattaaatgtttttcgtcactgggtggaacaccatttttat
gattttgaaagagatctggagctactagagagattggagacgtttatttcaagtgtaaga
ggaaaatccatgaagaagtgggtggaatcgattgctaaaatcatcaagagaaagaaagca
caggcaaatgggatcagtcacaatatcacctttgagagtccacctccccccatcgagtgg
cacatctggcgtgtggggcacagtgagatgctggacctcatgactctgcatcccatcgaa
atcgctcggcagctgacactgctcgagtctgacctgtacagggcagtgcagccttctgaa
ctcgtcggtagcgtttggactaaagaagataaggaaattaactccccaaatctattgaaa
atgattcgccatactacaaatctgactctgtggtttgaaaagtgcatagtggaaactgag
aactttgaagagcgagtggccgtgctgagcaggattatagaaatcctgcaagtgtttcaa
gatctgaacaatttcaatggtgttttggagatagtcagtgcaatgaactctgtgtcggtg
tacagactagatcacacatttgaggcactacaggaaaggaaaaagagagttttggatgaa
gcagtagaactaagtcaagatcacttcaaaaaatacctagctaagctcaagtcaatcaat
ccaccctgtgtgcctttctttggaatatacctaacaaatattttgaagacagaagaaggg
aatcctgacttccttaagagacaagggaaagaattaattaatttcagtaagaggagaaaa
gtggctgaaattacaggagaaattcagcagtatcaaaaccagccttactgtttgcggata
gagccagaaattcggaaattctttgaaaatctcaatcctatggggaagatacctgaaaaa
gagtttacagattatctgttcaacaagtcattagaaattgaacctcgaaactgcaagcaa
cctcctagatttcctaggaaaacaacgtacccactcaagtctcctgggataaggcccaat
gctggcaggcacggctccacctctggcaccttgagaagtcacccactgccacttgaaaag
gagccgagtaagataagtttcagtcgaatcactgaggcggagcacgaatcagcagtgtct
gcaccaacctctcccaacacaccttccactccccccgtgtctgcgtcgtcagagttcagc
gtatttttagacattgatctcaacagttcttatggtagcaacagcatcttcgctcctgtc
agtttgcctcagtcaaagactttcttcagctcatggggtagctttcctaagctaagtgat
gagcctcaaaaccctcctccgcttcctcctcgaaaaaagatggatcaggatgtttctaat
gctaagggaagtctgaaatcagatgatgatcctccagcaattccacctcggcagccgcca
cctccaaagatccagcctcgtgctcctgcttacagcccctttgagcagcctctgcacagc
cctcctcctcctccccctcgggatcctctccccgacactccacctccggtacctcaccgg
cctcccgaacactttatcaactgccctctaaacctgcagccgccgccggtgggccgcatg
cacagagatcccgactggttccgggaggctggcccaggccccagctctccaggcactcct
cccagcactccctctccacgggtgctgcgtcgctgctgcgtgatcggcgcctctcacaac
agcccgggtcacctgcctgcaccccccgtcccacccaggcagaattcaagccctcagctc
ccaaagctgccaccaaagacttacaaaagggagctctcccacccccctttgcacagactg
tctttgctagaaaatgcagaagctcctcaatga

DBGET integrated database retrieval system