KEGG   Meleagris gallopavo (turkey): 100540230Help
Entry
100540230         CDS       T01523                                 

Gene name
SOS2
Definition
son of sevenless homolog 2 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100540230 (SOS2)
   04012 ErbB signaling pathway
    100540230 (SOS2)
   04630 Jak-STAT signaling pathway
    100540230 (SOS2)
   04068 FoxO signaling pathway
    100540230 (SOS2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100540230 (SOS2)
  Cell communication
   04510 Focal adhesion
    100540230 (SOS2)
   04540 Gap junction
    100540230 (SOS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100540230 (SOS2)
   04912 GnRH signaling pathway
    100540230 (SOS2)
  Development
   04320 Dorso-ventral axis formation
    100540230 (SOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 1330 aa AA seqDB search
MQPPPQPYEFFGEENGPKWRGLFVPALRKVQQQVHPNLSAKEDSLYYIEELILQLLNKLC
IAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPLLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHFEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRNEIAEERQYLRELNLIIKVFREAFLSNRKLFTPNDI
DVVFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPQFHEHFNNLMAKPAVALHFQSTAEGFKEAVRYVLPRLMLIPVYHCLHYFELLQQLQE
CSEDEEDRECLKQAITALLNLQCSMERIYSKHSPRRRPGEPVCRFYNRQIRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGTLTKIGAKHERHIFLFDGLMISCKTNHGQSRLPG
YSNAEYRLKEKIIMRKIQIIDKDDTSEYKHAFELVSKDENSILFAAKSAEEKSNWMAALI
SLQYRSTLDRMLDSVLLQEENEQPLRLPSPNVYRFVVEDSEDNIVFEDNLQSRNGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADRLA
IEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLETFISSVR
GKSMKKWVESIAKIIKRKKAQANGISHNITFESPPPPIEWHIWRVGHSEMLDLMTLHPIE
IARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETE
NFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAMNSVSVYRLDHTFEALQERKKRVLDE
AVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRQGKELINFSKRRK
VAEITGEIQQYQNQPYCLRIEPEIRKFFENLNPMGKIPEKEFTDYLFNKSLEIEPRNCKQ
PPRFPRKTTYPLKSPGIRPNAGRHGSTSGTLRSHPLPLEKEPSKISFSRITEAEHESAVS
APTSPNTPSTPPVSASSEFSVFLDIDLNSSYGSNSIFAPVSLPQSKTFFSSWGSFPKLSD
EPQNPPPLPPRKKMDQDVSNAKGSLKSDDDPPAIPPRQPPPPKIQPRAPAYSPFEQPLHS
PPPPPPRDPLPDTPPPVPHRPPEHFINCPLNLQPPPVGRMHRDPDWFREAGPGPSSPGTP
PSTPSPRVLRRCCVIGASHNSPGHLPAPPVPPRQNSSPQLPKLPPKTYKRELSHPPLHRL
SLLENAEAPQ
NT seq 3993 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgccgccgcagccctacgagttcttcggtgaggagaacggcccgaaatggcgg
gggctgttcgtgcccgccctgcgcaaggttcagcaacaggttcaccccaacctttcagca
aaggaagattccctctactacattgaggagttgatacttcagctgctaaacaagctatgc
atcgcccagccacgcacagtccaagacgtagaggagcgtgttcagaagacgtttcctcat
cccatagacaaatgggccattgctgatgcacagtctgccatagagaaacggaaaagaaga
aaccctctcctgctgcctgtggacaaaatacaccccttattaaaggaggtcctgggttat
aaagtagattaccatgtctctctgtatattgtggctgtcttagaatacatctcagctgat
attttaaagctggctggaaactacgttttcaatatacgacactttgagatctcccagcag
gacattaaagtatccatgtgtgctgataaggttttgatggatatgtttgatcaggatgac
attggcttggtttctctctgtgaagacgaaccttcttcttccggggaactcaattattat
gacctagtgagaaatgaaattgcagaagaaaggcaatatctccgggagctgaatctgata
ataaaagtatttcgggaagctttcctctctaacagaaagttgttcacacctaatgacatt
gatgtggtgttcagcaacatttcagatattcatgagttgacagtgaagcttttgggattg
attgaggatactgttgaaatgactgatgagagcagtcctcatcctctggctggcagctgc
tttgaggatcttgctgaggaacaagcctttgatccatatgaaaccttgtcccaggatatt
ctctctccacaatttcatgagcattttaataacttaatggcaaaacctgctgttgctctt
cacttccagtctactgctgaaggttttaaagaagctgtacgatatgtcctcccacggctc
atgcttatcccagtctatcattgtttgcactactttgagttactgcagcaactgcaggaa
tgcagtgaagatgaggaggatcgggagtgcttaaaacaagccattactgctcttctgaat
ctccagtgcagcatggagcgcatctacagcaaacactccccaagacgtcggcctggggag
ccagtttgtcgcttctataaccggcaaataagaagcaagcacttggccatcaagaaaatg
aacgaaatccagaaaaatattgatggctgggaaggcaaagatattgggcagtgctgtaat
gaattcataatggaaggcaccttgacaaaaataggagctaaacacgaacgacacatcttc
ctctttgatggcttaatgatcagctgtaaaactaaccatggccagtcacggctccccggt
tacagcaacgcggagtatagactgaaggaaaagataatcatgaggaaaatacagattatt
gataaagatgacacatctgaatataaacatgcttttgaactggtgtctaaagatgaaaac
agtatactctttgctgccaagtctgctgaagagaagagtaattggatggctgctctgatt
tccctccagtaccggagcactcttgataggatgctcgactcagtgctactgcaagaggaa
aatgaacagccactgaggttgcccagcccaaacgtgtaccgctttgtagtagaagattct
gaggataacattgtttttgaggacaacttgcaaagcaggaatgggattcccatcatcaaa
ggaggaacggttgtgaaattaattgagaggctaacgtaccatatgtatgcagatcccaat
tttgtacgtactttccttaccacgtaccgttccttttgcaagccccaggaactgctgagt
ttactgattgaaaggtttgaaatcccagagcctgagcctactgaagcagacaggctggca
atcgagaaaggggagcagcccatcagtgcagaccttaagcgatttcgcaaggaatacgtc
cagccagtgcaactcagaatattaaatgtttttcgtcactgggtggaacaccatttttat
gattttgaaagagatctggagctactagagagattggagacgtttatttcaagtgtaaga
ggaaaatccatgaagaagtgggtggaatcgattgctaaaatcatcaagagaaagaaagca
caggcaaatgggatcagtcacaatatcacctttgagagtccacctccccccatcgagtgg
cacatctggcgtgtggggcacagtgagatgctggacctcatgactctgcatcccatcgaa
atcgctcggcagctgacactgctcgagtctgacctgtacagggcagtgcagccttctgaa
ctcgtcggtagcgtttggactaaagaagataaggaaattaactccccaaatctattgaaa
atgattcgccatactacaaatctgactctgtggtttgaaaagtgcatagtggaaactgag
aactttgaagagcgagtggccgtgctgagcaggattatagaaatcctgcaagtgtttcaa
gatctgaacaatttcaatggtgttttggagatagtcagtgcaatgaactctgtgtcggtg
tacagactagatcacacatttgaggcactacaggaaaggaaaaagagagttttggatgaa
gcagtagaactaagtcaagatcacttcaaaaaatacctagctaagctcaagtcaatcaat
ccaccctgtgtgcctttctttggaatatacctaacaaatattttgaagacagaagaaggg
aatcctgacttccttaagagacaagggaaagaattaattaatttcagtaagaggagaaaa
gtggctgaaattacaggagaaattcagcagtatcaaaaccagccttactgtttgcggata
gagccagaaattcggaaattctttgaaaatctcaatcctatggggaagatacctgaaaaa
gagtttacagattatctgttcaacaagtcattagaaattgaacctcgaaactgcaagcaa
cctcctagatttcctaggaaaacaacgtacccactcaagtctcctgggataaggcccaat
gctggcaggcacggctccacctctggcaccttgagaagtcacccactgccacttgaaaag
gagccgagtaagataagtttcagtcgaatcactgaggcggagcacgaatcagcagtgtct
gcaccaacctctcccaacacaccttccactccccccgtgtctgcgtcgtcagagttcagc
gtatttttagacattgatctcaacagttcttatggtagcaacagcatcttcgctcctgtc
agtttgcctcagtcaaagactttcttcagctcatggggtagctttcctaagctaagtgat
gagcctcaaaaccctcctccgcttcctcctcgaaaaaagatggatcaggatgtttctaat
gctaagggaagtctgaaatcagatgatgatcctccagcaattccacctcggcagccgcca
cctccaaagatccagcctcgtgctcctgcttacagcccctttgagcagcctctgcacagc
cctcctcctcctccccctcgggatcctctccccgacactccacctccggtacctcaccgg
cctcccgaacactttatcaactgccctctaaacctgcagccgccgccggtgggccgcatg
cacagagatcccgactggttccgggaggctggcccaggccccagctctccaggcactcct
cccagcactccctctccacgggtgctgcgtcgctgctgcgtgatcggcgcctctcacaac
agcccgggtcacctgcctgcaccccccgtcccacccaggcagaattcaagccctcagctc
ccaaagctgccaccaaagacttacaaaagggagctctcccacccccctttgcacagactg
tctttgctagaaaatgcagaagctcctcaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system