KEGG   Meleagris gallopavo (turkey): 100540237Help
Entry
100540237         CDS       T01523                                 

Definition
eukaryotic translation initiation factor 4E type 2-like
Orthology
K03259  
translation initiation factor 4E
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100540237
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100540237
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100540237
Translation factors [BR:mgp03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100540237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 234 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENNTQKDSEKEKNDREKPQSTTKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKDNSSFRNTKITL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaattcgacgcattgaaagatgatgatagtggagaccatgaccagaacgag
gagaataacacacagaaagacagtgagaaggaaaagaatgatcgagagaaaccacagagt
accaccaagaggaaggcagttgtcccgggaccagctgagcatcccttgcagtataattac
actttctggtactccagacgaacacctgggaggcctaccagctcacagagttatgaacag
aacatcaaacaaattggcacctttgcctcagtggagcagttctggcggttttacagtcac
atggtacgtcctggggacctgacaggccatagtgacttccatcttttcaaagagggcatc
aaacccatgtgggaggatgatgccaacaaaaatggtggtaaatggattatccgtctgcgg
aagggcttagcgtcacgatgttgggagaatctcattctggccatgcttggagaacagttt
atggtgggcgaagaaatctgtggggcagtcgtctctgtccgattccaggaggacattatc
tcgatatggaacaagacagccagcgaccaggccacgacagcccggatacgcgacacgtta
cgaagagtgctcaacctacctcccaacaccatcatggaatataaaacacacaccgacagc
atcaaggataattcaagctttcgaaacacaaaaatcacattgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system