KEGG   Meleagris gallopavo (turkey): 100540259Help
Entry
100540259         CDS       T01523                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04068  FoxO signaling pathway
mgp04218  Cellular senescence
mgp04261  Adrenergic signaling in cardiomyocytes
mgp04370  VEGF signaling pathway
mgp04620  Toll-like receptor signaling pathway
mgp04621  NOD-like receptor signaling pathway
mgp04622  RIG-I-like receptor signaling pathway
mgp04625  C-type lectin receptor signaling pathway
mgp04912  GnRH signaling pathway
mgp04914  Progesterone-mediated oocyte maturation
mgp04933  AGE-RAGE signaling pathway in diabetic complications
mgp05132  Salmonella infection
mgp05164  Influenza A
Module
mgp_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100540259 (MAPK12)
   04370 VEGF signaling pathway
    100540259 (MAPK12)
   04068 FoxO signaling pathway
    100540259 (MAPK12)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100540259 (MAPK12)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100540259 (MAPK12)
   04621 NOD-like receptor signaling pathway
    100540259 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    100540259 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    100540259 (MAPK12)
  Endocrine system
   04912 GnRH signaling pathway
    100540259 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    100540259 (MAPK12)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100540259 (MAPK12)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100540259 (MAPK12)
  Infectious diseases
   05132 Salmonella infection
    100540259 (MAPK12)
   05164 Influenza A
    100540259 (MAPK12)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100540259 (MAPK12)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100540259 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH Kinase-like UvrD_C Kdo
Motif
Other DBs
NCBI-GeneID: 100540259
NCBI-ProteinID: XP_019467729
Ensembl: ENSMGAG00000008074
Position
1
AA seq 284 aa AA seqDB search
MKHENVIGILDVFTPDVTLEKFNGFYLVMPFMGTDLSKIMKHEKLTEDRIQFLVYQILKG
LKYIHSSGIIHRDLKPGNLAVNEDCELKILDFGMARHTDSEMTGYVVTRWYRAPEVILNW
MHYTQTVDIWSVGCIMAEMIMGRPLFRGNDHLDQLKEIMKITGTPSQDFVQKLKSQEAKN
YIKSLPKVQKKDFASVLKHASPLAVNLLENMLVLDAEERVTAAEALMHPYFEPIHDPEEE
IEAEKYYETFDNMDLTLDEWKRVTYKEILNFKPPQTSESKETAV
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacgaaaacgtgattggaatactggatgtgttcacaccagatgtcacactggag
aaatttaatggcttctacctcgtcatgccatttatgggaacagacttaagtaagataatg
aagcatgagaaactcactgaagaccgaatccagttcttggtatatcagatattaaaaggc
ttaaagtatattcactcatctggtataattcacagggacctaaagcctggaaacctggca
gtaaatgaagactgtgaattgaagatcctggattttggaatggccaggcatacggacagt
gagatgacaggttacgtggttacaaggtggtacagagccccagaggtcatccttaattgg
atgcattacacacaaacagttgacatctggtctgtgggctgtataatggctgaaatgata
atggggaggcctctgttcaggggaaacgaccatctggatcaactcaaagaaataatgaaa
ataacgggtacaccaagtcaagattttgtgcaaaaactgaagagtcaggaagcaaaaaac
tatatcaaaagccttccaaaagtccagaaaaaggattttgcatccgtcttgaagcacgcg
agccctttggctgtaaatcttttggagaacatgctggtgctggatgcggaggagcgagtc
acggcagctgaggctttgatgcatccttactttgaaccaattcacgatcctgaggaagaa
attgaggctgagaaatattatgagacatttgataacatggatctaaccctggatgagtgg
aagcgtgttacatataaagagatactgaacttcaagccaccacaaacatcagagtcaaag
gagacagcagtgtaa

DBGET integrated database retrieval system